SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060525 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060525
Domain Number 1 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 389-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 21-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 5 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 526-578
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 568-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000017
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 9 Region: 234-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 10 Region: 100-159
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000631
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 11 Region: 639-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000249
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060525   Gene: ENSPTRG00000028867   Transcript: ENSPTRT00000075896
Sequence length 690
Comment pep:novel chromosome:CHIMP2.1.4:19:62871891:62893812:1 gene:ENSPTRG00000028867 transcript:ENSPTRT00000075896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPGDIHRMIWDYTAIVNHGNSVQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLA
LMSSLGCWCGVEDEAAPSKQSIYIQRETQVRTPMTGVSPKKAHPCEMCGPILGDILHVAD
HQGTHHKQKLHRCEAWGNKLYDSGNFHQHQNEHIGEKPYRESVEEALFAKRCKLHVSGES
SVFSENGKDFLPRSGLLQQEASHTGEKSNSKTECVSPIQCGGAHYSHGDSMKHFSTKHIL
SQHQRLLPREECYVCCECGKSFSKYVSFSNHQRVHTVKRPYECGECGKSFSHQSSFSNHQ
RVHTGKRPYECGECGKSFSKYVSFSNHQRVHTDKKHYECGECGKSFSKYVSFSNHQRVHT
GEKPYGCEECGKSFSQKSSLIQHQQFHTGGKPYGCEECGKYFSKDILAGHQRIHTGERPY
KCGECEKSFSRKGHLRSHQRVHTTERPYKCGECGKCFSHKGNLILHQHGHTRKRPYMCWE
CGKLFKKKSHLLVHQRIHSGEKPYACEACQKFFRHKCHLTAHQRVHTGERPYECSDCGKS
FTHSCAFIVHKRVHTGQKPYECSECGKSFAASSYLTSHRRVHTGQKPECSECGKSFAGIS
SLTNHRRVHTGEKPYGCSECEKKFRKSSSLRYRQRVHKERPYECRESSLIKYRRAHTVRS
CDCSKCGKCLPERSALLGHWRVHTEKSPYK
Download sequence
Identical sequences ENSPTRP00000060433 ENSPTRP00000060525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]