SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060568 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060568
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 5.48e-29
Family Pleckstrin-homology domain (PH domain) 0.0000049
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-27
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060568   Gene: ENSPTRG00000016309   Transcript: ENSPTRT00000075682
Sequence length 280
Comment pep:known chromosome:CHIMP2.1.4:4:102294185:102343682:1 gene:ENSPTRG00000016309 transcript:ENSPTRT00000075682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK
Download sequence
Identical sequences G3QFN7 H2QPY0 Q9UN19
hsi002011017.1 ENSPTRP00000028016 ENSP00000423602 ENSGGOP00000001114 ENSP00000423602 ENSPTRP00000060568 gi|158631203|ref|NP_055210.2| 9598.ENSPTRP00000028016 9606.ENSP00000296414 ENSP00000423602 ENSGGOP00000001114 NP_055210.2.87134 NP_055210.2.92137 XP_003829986.1.60992 XP_004040230.1.27298 XP_517361.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]