SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060684 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060684
Domain Number 1 Region: 191-366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-44
Family SPRY domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060684   Gene: ENSPTRG00000040923   Transcript: ENSPTRT00000072747
Sequence length 390
Comment pep:known chromosome:CHIMP2.1.4:17:37152138:37164754:-1 gene:ENSPTRG00000040923 transcript:ENSPTRT00000072747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AELQCTQDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVM
LFLEEKEQAALSQANDIKAHLEYRSAEMEKSKQELETMAAISNTVQFLEEYCKFKNTEDI
TFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAVVQRK
YWTSKPEPSTREQFLQYAYDITFDPDTAHKYLQLQEENRKVTNTTPWEHPYPDLPSRFLH
WRQVLSQQSLYLHRYYFEVEIFGEGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGK
EFTAWYSDMETPLKAGPFRRLGVYIDFPGGILSFYGVEYDTMTLVHKFACKFSEPVYAAF
WLSKKENAIRIVDLGEEPEKPAPSLVGTAP
Download sequence
Identical sequences ENSPTRP00000060684 ENSPTRP00000060684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]