SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061333 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061333
Domain Number 1 Region: 14-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.09e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061333   Gene: ENSPTRG00000010649   Transcript: ENSPTRT00000072964
Sequence length 587
Comment pep:known chromosome:CHIMP2.1.4:19:16854276:16907555:-1 gene:ENSPTRG00000010649 transcript:ENSPTRT00000072964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAAPASPQQIRDRLLQAIDPQSNIRNMVAVLEVISSLEKYPITKEALEETRLGKLINDV
RKKTKNEELAKRAKKLLRSWQKLIEPAHQHEAALRGLAGATGSANGGAHNCRPEVGAAGP
SRSIHDPESPHDPQKLPGQRLDRLGPPPKVSKAGHEPPLVPHSSPPPPPNGVSGSPESFA
SSLDGSGHAGPEGSRLERDENDKHSGKIPVNAVRPHTSSPGLGKPPGPCLQPKASVLQQL
DRVDETPGPPHPKGPPRCSFSPRNSRHEGSFARQQSLYAPKGSVPSPSPRPQALDATQVP
SPLPLAQPSTPPVRRLELLPSAESPVRWLEQPESHQRLAGPGCKAGLSPAEPLLSRAGFS
PDSSKADSDAASSGGSDSKKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQ
IKPLTQKEPVRADSPVHMEQQSRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQ
SSLLSSSGAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLD
RIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD
Download sequence
Identical sequences ENSPTRP00000018177 ENSPTRP00000061333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]