SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000021 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000021
Domain Number 1 Region: 219-248
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000000138
Family Intermediate filament protein, coiled coil region 0.003
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000000021
Domain Number - Region: 23-81
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00759
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000021   Gene: ENSSARG00000000022   Transcript: ENSSART00000000022
Sequence length 297
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5664:18480:21382:-1 gene:ENSSARG00000000022 transcript:ENSSART00000000022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILAATVDNANVLLQIDNARLAADDFRTKYETELNLRMSVEADTNGLRRVLDELTLARADL
EMQIESLKEELAYLRKNHEEEMSSLRGQVGGDVNVEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEYKILLDVKSRLEQEIATY
RRLLEGEDAHLSSAQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSSHEQVLRTKN
Download sequence
Identical sequences ENSSARP00000000021 ENSSARP00000000021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]