SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000431 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000431
Domain Number 1 Region: 100-204
Classification Level Classification E-value
Superfamily EF-hand 1.11e-26
Family Eps15 homology domain (EH domain) 0.00000704
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily EF-hand 2.18e-20
Family Eps15 homology domain (EH domain) 0.0000155
Further Details:      
 
Domain Number 3 Region: 207-255
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000129
Family Eps15 homology domain (EH domain) 0.00029
Further Details:      
 
Domain Number 4 Region: 324-414
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000118
Family Myosin rod fragments 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000000431
Domain Number - Region: 429-493
Classification Level Classification E-value
Superfamily Tropomyosin 0.00235
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000431   Gene: ENSSARG00000000475   Transcript: ENSSART00000000478
Sequence length 838
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_824:15430:268478:-1 gene:ENSSARG00000000475 transcript:ENSSART00000000478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSGNPVYEKYYRQVDTGNTGRVLASEAAAFLKKSGLPDLVLGKIWDLSDTDGKGILNKQ
EFFVALRLVACAQNGLEVSLNSLNLAVPPPRFHDTSSPLLVGGTAAADLPWAVKSEDKAK
YDAIFDSLSPENGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFL
VYCALEKEPVPMSLPPAVVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREI
FLKTGLPSTLLAHIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXSVIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKEDTIKQRTSEVQ
DLQDEVERENTNLQKLQAQKQQVQELLDGLDEQKAQLEEQLKEVRKKCAEEAQLXXXXXX
XXXXXXXXISTYEEELARAREELNRLQQETAELEESVESGKAQLGPLQQQLQDSQQEISS
MQMKLMEMKDLENHNNQLNWCSSPHNVLVNGATDYCSLSTSSSEAANLNEHAENQSTLES
EPIQQESPARTSPEMQPGDVTDENEVVTAAANEKVCPDFNNERHSKEEDPFNVESSSLTD
PVADSNLDFFQSDPFVGSDPFKDDPFGKIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVETLKCNDPFAPGGTVVVAARDSXXXXXXXXXXXXXXXXXXXXXXX
XXXANNEDPFSSAASSSVSSVVITKNVLEEASVKNEDIPPALPPKIGTPTRPCPPPPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSFANFSA
Download sequence
Identical sequences ENSSARP00000000431 ENSSARP00000000431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]