SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000000731 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000000731
Domain Number 1 Region: 588-651,824-943
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.67e-39
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 
Domain Number 2 Region: 919-1042
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-26
Family Ypt/Rab-GAP domain of gyp1p 0.011
Further Details:      
 
Domain Number 3 Region: 8-95
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000000000628
Family RUN domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000000731   Gene: ENSSARG00000000777   Transcript: ENSSART00000000796
Sequence length 1050
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_5382:98110:160040:1 gene:ENSSARG00000000777 transcript:ENSSART00000000796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSAEDAVKEKLLWNVKKEVKQIMEEAVTRKFVHEDSSHIIALCGAVEACLLHQLRRRAA
GFLRSDKMAALFTKVGKTCPVTGKICHKVQELQQQVEGXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLVHEHGNRGFPLSRKDFPAKRPVTGIRKRHSSGSTSEDRL
AACAREYVESLHQNSRTRLLYGKNNVLVQPKEDMEAVPGYLSLHQSADSLTLKWTPNQLM
NGTLGDSELEKSVYWDYALVVPFSQIVCIHCHQQKCGGTLVLVSQDGIQRPPLHFPQGGH
LLSFLSCLENGLLPRGQLEPPLWTQQGKGKVFPKLRKRGSMRSVDVEEMAMGRATDYVFR
IIYPGHKHEHITINYHHLAASRPASVDDDEEEEDKLHAMLSMICSRNLTAPNPMKDAGDM
IEMQGFGPGLPVWHLEPLCNQGSSCLSCSTSSSPYATPSHCNCVPDRLPLRLLCESMKRQ
IVSRAFYGWLAYCRHLSTVRTHLSALVHHNIIPPARPPGASGGLTKDVWSKYQKDEKNYK
ELELLRQVYCGGVEHEIRKDVWPFLLGHYKFGMSKKEMEQVDTAVAARYQRVLAEWKACE
MVVRQREREAHPTTLTKFSSGSSIDSHVQRLIHRDSTISNDVFISVDDLEPPKPLGSEDS
QAEPEQAPGGGTPSTAVVEQQQSVEFDSPDSGLPSSRNYSMASGIQSSIDEGQSVGFEED
YGGGEPDASGPAAHVFSEPHDPTQKVSSANELEAGEELAAVCAAAYTIELLDTVALNLHR
IDKDVQRCDRNYWYFTPPNVERLRDIMCSYVWEHLDMGYVQGMCDLLAPLLVILDNDQLA
YSCFSHLMKRMSQNFPNGGAMDTHFANMRSLIQILDSELFELMHQNGDYTHFYFCYRWFL
LDFKRELLYEDVFAVWEVIWAARHISSEHFVLFIALALVEAYREIIRDNNMDFTDIIKFF
NERAERHDAQEILRIARDLVHKVQMLIENK
Download sequence
Identical sequences ENSSARP00000000731 ENSSARP00000000731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]