SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001375 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001375
Domain Number 1 Region: 710-786,820-909
Classification Level Classification E-value
Superfamily RUN domain-like 6.8e-36
Family RUN domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000001375
Domain Number - Region: 1190-1242
Classification Level Classification E-value
Superfamily RUN domain-like 0.000798
Family RUN domain 0.026
Further Details:      
 
Domain Number - Region: 596-669
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.049
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001375   Gene: ENSSARG00000001503   Transcript: ENSSART00000001514
Sequence length 1249
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6351:6422:103030:-1 gene:ENSSARG00000001503 transcript:ENSSART00000001514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQYIQASKARDGGSPFISSTTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
LCMPKGLAFKTQADARDPQFHAFIITREDGSRTFGFALTFFEEVTSKQCSAMQTLYHMHN
AXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQRLMTVAETITALMFPFQWQ
HVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEANLCFVDIDNHFIELPEDL
PQFPNKLEFVQEVSEILMAFGIPPEGNLHCSESASKLKRLRASELVSDKRNGNIASSPLH
TYELLKENETIARLQALVKRTGVSLEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXFADYEVFVIQPSQYKESWFTNREQMQNFDKASFLSDQPEPYLPFLSRFLET
QMFASFIDNKIMCHDEDDKDPVLRVFDSRVDKIRLLNVRTPTLRTSMYQKCTTVDEAEKA
IELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQSDVLSTGPASNKWTKRNAPAQWRR
KDRQKQHTEHLRLDNDQREKYIQEARSMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKEC
RNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQGKSALW
SHLLHYQENRQRNLTSGSLGSSGILLDSERRKSDASSVMSPLRISLIQDMRHIQNIGEIK
TDVGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFN
AVDYFCFTNVFTTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHLLYHWIALL
ADCPITAHMYEDVALIKDHTLVNSLIRVLQTLQEFNITLETSLVKGIDI
Download sequence
Identical sequences ENSSARP00000001375 ENSSARP00000001375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]