SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001395 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001395
Domain Number 1 Region: 2-163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-46
Family Motor proteins 0.000000148
Further Details:      
 
Domain Number 2 Region: 280-387
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.7e-19
Family Myosin rod fragments 0.00045
Further Details:      
 
Domain Number 3 Region: 687-794
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.92e-19
Family Myosin rod fragments 0.0023
Further Details:      
 
Domain Number 4 Region: 437-517
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000105
Family Myosin rod fragments 0.0016
Further Details:      
 
Domain Number 5 Region: 794-893
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000144
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001395   Gene: ENSSARG00000001507   Transcript: ENSSART00000001534
Sequence length 1127
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1071:329:20897:-1 gene:ENSSARG00000001507 transcript:ENSSART00000001534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKPKQLKDKADFCIMHYAGKVDYKADEWLMKNMDPLNDNIATLLHQSSDKFVSELWKDVD
RIIGLDQVAGMSETAMPGAFKTRKGMFRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNH
EKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKPLLQVSRQEEEMMAKEEELVK
VREKQLAAENRLTEMETLQSQLMAEKMQLQEQLQAETELCAEAEELRARLTAKKQELEEI
CHDLEARVEEEEEHCQHLQAEKKKMQHMNIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXEKKLLEDRIAEFTTNLTEEEEKSKSLAKLKNKHEAMISDLEER
LRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAKKEEELQAALAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKANL
EKAKQTLESERGELASEVKALLQGKGDSEHRRKKAEAQLQELQGKLAEGERTRTELADKV
SKLQVELDNVTGLLSQSDSKSSKLTKDFSTLESQLQDTQEQLQEENRQKLSLSTRLRQLE
DEKNSFREQLEEEEEAKRNLEKQVASLQMQVSDMKKRMEDGVGCLETAEEAKKKLQKDLE
GLGQRFEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVCNLEKKQKKFDQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKQRSMDAAKLEMDKDEAHIDTANKNRDEAIKQL
RKLQAQMKDYMRELEDTRASREDILAQAKENEKKLKSMEAEMIQLQE
Download sequence
Identical sequences ENSSARP00000001395 ENSSARP00000001395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]