SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001571 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001571
Domain Number 1 Region: 21-186
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-31
Family RUN domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001571   Gene: ENSSARG00000001714   Transcript: ENSSART00000001730
Sequence length 945
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3862:42849:90606:-1 gene:ENSSARG00000001714 transcript:ENSSART00000001730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPEGAAVERGGRGSPPEESRREHWQLLGNLKTTVEGLVSANSPNVWSKYGGLERLCRDM
QSILYHGLIHDQVCCRQADYWQFVKDIRWLSPHSALHVEKFIDLHENEQNSSGEENERAV
AELWLQHSLQSHCLSAQLRPLLGDRQYIRKFYTETAFLLSDAHVTAMLQCFEAVEQNNPR
LLAQIDASMFAGKQESPLLSTKSQSLTALPGSTHAPPPGSTQPSYFGSFSSLQPVSNNNS
GTERRSTSFSLSGPQRPQESRGHSSPTEGQTAQDALLLSSPVAKDSLSTPHEMSSSTLTS
PIETSWVSSQDESPSEASEGPEYLAIGNPGPQGWTARCQSHGGSEENSISQKLESAAASL
GGQEGGGQSPLPSVLRRSSFSEGQILTVPSGTKKCHTRSHSDTNIASRGAPGGPRSVTII
VEDPIAESGQHLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSHCFSHSTSA
EAVAMGLLKQFEGMQLPAASELEWLVAEHEAPQKLLPIPDSLPISPDDGQHADIYKLRIR
VRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYF
CQCCHENAQVVIPSRILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLLRIQLYHMKNMFKTCRLAKELLDSFDVVPGHLTEDLHLYSLNDLTATKKGELGPR
LAELARTGAAHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKVCFKS
GSCPRCERLQARRELMARQSLESYMSDYEEPTEALELEASVLETT
Download sequence
Identical sequences ENSSARP00000001571 ENSSARP00000001571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]