SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000002944 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000002944
Domain Number 1 Region: 177-246
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.73e-17
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000002944
Domain Number - Region: 11-81
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0955
Family Myosin rod fragments 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000002944   Gene: ENSSARG00000003265   Transcript: ENSSART00000003250
Sequence length 306
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_6509:99207:134073:-1 gene:ENSSARG00000003265 transcript:ENSSART00000003250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VISANIGNAQMILQIDNARWAAEDFRMKYENEQTLHMSVKADTNGLRQVLDELTLSRADL
ETQIEGLTEELVYLKKNHEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSLE
DSLAEVESGSCSQLAQLQQLISSVEAQLLQVREDTERQNADHLRLLSIKASLELEIETYR
RLLDREAQGDDLDESSSVTESESKSQAQSIDSSKDSTKTRKIKTIVQEVINGEVVSSQIQ
ETEEAI
Download sequence
Identical sequences ENSSARP00000002944 ENSSARP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]