SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003109 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003109
Domain Number 1 Region: 1055-1105
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.0000000000366
Family Eferin C-derminal domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 423-545
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000111
Family Tropomyosin 0.0075
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000003109
Domain Number - Region: 511-618
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000175
Family Myosin rod fragments 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003109   Gene: ENSSARG00000003374   Transcript: ENSSART00000003427
Sequence length 1115
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_775:38994:404333:1 gene:ENSSARG00000003374 transcript:ENSSART00000003427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGSARSVGKVEPSNQSPGRSPRLPRSPRLGHRRTNSTGGSSGSTVGGGSGKTLSMENIQ
SLNAAYATSGPMYLSDHENVGSETPKSTMTLGRSGGRLPYGVRMTAMGSSPNIASSGVAT
DAIAFGEHHLPPVSMASTVPHSLRQARDNTIMDLQTQLKEVLRENDLLRKDVEVKESKLS
SSMNSIKTFWSPELKKERALRKDEASKITIWKEQYRVVQEENQHMQMTIQALQDELRIQR
LNQLFQQDSSSRTGEPCVAELTEENFQRLHAEHERQAKELFLLRKTLEEMELRIETQKQT
LNARDESIKKLLEMLQSKGLSAKATEEDHERTRRLAEAEMHVHHLESLLEQKEKENNMLR
EQMHRRFENAPDSAKTKALQTVIEMKDSKISSMERGLRDLEEEIQMLKSNGALSTEEREE
EMKQMEVYRSHSKFMKNKVEQLKEELSSKEAQGEELRQRAAGLQAEIGQVKQELSRKDTE
LLALQTKLETLTNQFSDSKQHIEVLKESLTAKEQRAAILQTEVDALRLRLEEKETMLNKK
TKQIQDMAEEKGTQAGEIHDLKDMLDVKERKVNVLQKKIENLQEQLRDKEKQMSSLKERV
KSLQADTTNTDTALTTLEEALAEKERTIERLKEQRDRDEREKQEEIDNYKKDLKDLKEKV
SLLQGDLSEKETSLLDLKEHASSLASSGLKKDSRLKTLEIALEQKKEECLKMESQLKKAH
EATLEARASPEMSDRIQQLEREIARYKDESSKAQAEVDRLLEILKEVENEKNDKDKKIAE
LERQVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQDSLRKKDDRIEE
LEEALRESVQITAEREMVLAQEESARTSAEKQVEELLMAMEKVKQELESMKAKLSSTQQS
LAEKETHLSNLRAERRKHLEEVLEMKQEALLAAISEKDANIALLELSSSKKKTQEEVAAL
KREKDRLVQQLKQQTQNRMKLMADNYEDDHFKSSHSNQTNHKPSPDQIIQPLLELDQNRS
KLKLYIGHLTALCHDRDPLILRGLTPPASYNLNDDQAAWETELQKMTREQXXXXXXXXEQ
DNAELQEFANTILQQIADHCPDILEQVVNALEESS
Download sequence
Identical sequences ENSSARP00000003109 ENSSARP00000003109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]