SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003184 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003184
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000428
Family THAP domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000003184
Domain Number - Region: 119-173
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0785
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003184   Gene: ENSSARG00000003532   Transcript: ENSSART00000003516
Sequence length 190
Comment pep:known_by_projection scaffold:COMMON_SHREW1:scaffold_232729:36263:46550:1 gene:ENSSARG00000003532 transcript:ENSSART00000003516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPTDENVKRKWVLAMKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSTPNIKLKPGVVPS
VFDVPSHLQEKREKLHCRKNFTLKNHSDNHQLVASTCSEEFQSQFFEHSYSVMDSPKKLK
HKLDHVISELEDTKQSLRNVLDREKRFQKSLRKTIRELKDECLISQETANRLEAFCWECC
QESVERDYIS
Download sequence
Identical sequences ENSSARP00000003184 ENSSARP00000003184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]