SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003575 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003575
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-22
Family RUN domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003575   Gene: ENSSARG00000003953   Transcript: ENSSART00000003944
Sequence length 352
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_1612:5:5347:1 gene:ENSSARG00000003953 transcript:ENSSART00000003944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPIDDSSEEFVNFAAILEQILSHRFKACAPAGPVSWFSSDGQRGFWDYIRLACGKVPNN
CVSSIENMENISTARAKGRAWIRVALMEKRMSEYITTALRDTRTTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGLIPGDHAPLAQASKELVTPLVNQWPSL
GTLSGAEGTNNPKLYRRHSFMSPEPLSAEASLSSDSQRLGENKRDEEPWGPI
Download sequence
Identical sequences ENSSARP00000003575 ENSSARP00000003575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]