SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003859 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSARP00000003859
Domain Number - Region: 69-135
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003859   Gene: ENSSARG00000004265   Transcript: ENSSART00000004249
Sequence length 331
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_5295:3325:40870:1 gene:ENSSARG00000004265 transcript:ENSSART00000004249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQEARDELVEFQEGSRELEAELEAQLVQAEQRNRDLQADNQRLKYEVETLKEKLEHQYAQ
SYKQVSVLEDDLSQTRAIKEQLHKYVRELEQANDDLERAKRATIVSLEDFEQRLNQAIER
NAFLESELDEKESLLVSVQRLKDEARDLRQELAVRERQQEVTRKSAPSSPTLDCEKMDSA
VQASLSLPATPVGKGTENGFPSPKAIPNGFGTSPLTPSARISALNIVGDLLRKVGALESK
LAACRNFAKDQASRKSYISGNVNCGVMNSNGTKFSRSGHTSFFDKGSSSSCAIRASRRRF
SSSSADLAGPRSCCSTPTSGVSGRAPSPTPP
Download sequence
Identical sequences ENSSARP00000003859 ENSSARP00000003859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]