SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003984 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003984
Domain Number 1 Region: 36-213,240-262,298-528,640-737,811-845
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-173
Family Motor proteins 0.00000000000282
Further Details:      
 
Domain Number 2 Region: 843-953
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.62e-21
Family Myosin rod fragments 0.00032
Further Details:      
 
Domain Number 3 Region: 1352-1453
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000191
Family Myosin rod fragments 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000003984
Domain Number - Region: 1041-1078
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000149
Family Myosin rod fragments 0.0059
Further Details:      
 
Domain Number - Region: 1519-1632
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0068
Family Myosin rod fragments 0.0015
Further Details:      
 
Domain Number - Region: 1730-1946
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0032
Further Details:      
 
Domain Number - Region: 1318-1353
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0157
Family Myosin rod fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003984   Gene: ENSSARG00000004290   Transcript: ENSSART00000004384
Sequence length 1972
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_5295:36206:157129:-1 gene:ENSSARG00000004290 transcript:ENSSART00000004384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGKFIRINFDVTGYIVGANIETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDE
LKIQLAKKEEELQGALAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXFKANLDKNKQALETDNKDLACEGKVLQQVGAQSDHSKTWLVLE
LQAVSEGDRLRVELAERANKLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELL
QEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNMEKQVLALQSQLTDTKKKVDDDL
GTIESLEEAKKKLLRDVEALSQRLEEKALAYDKLEKTKNRLQQELDDLMVDLDHQRQIVS
NLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALEAKEESER
QNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATEDAKLR
LEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAIASKKKMEI
DLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEKKLKS
LEAEILQLQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSALLDEKRRLEARIAQLEEE
LEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAKLQEL
EGTVKSKFKATISALEAKISQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVEDERRH
ADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLTREVSTL
KNRLRRGGPISFSSSRSGRRQLHIEGTSLELSDDDTESKTSDVNETQPPQSE
Download sequence
Identical sequences ENSSARP00000003984 ENSSARP00000003984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]