SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000004347 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000004347
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily RUN domain-like 1.31e-36
Family RUN domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000004347   Gene: ENSSARG00000004787   Transcript: ENSSART00000004788
Sequence length 433
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_1477:8770:121404:1 gene:ENSSARG00000004787 transcript:ENSSART00000004788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVKTLIDRSCFETIDDSSPEFNNFAAILEQILSHRLKEISQSCRWLAHLILLQGQVTWF
GYESPRSFWDYIRVACRKVSQNCICSIENMENVNSSRAKGRAWIRVALMEKHLSEYISTA
LRDFKTTRRFYEDGAIVLGDEANMLAGMLLGLNAIDFXXXXXXXXXXXXXXXXXXXXXXX
XXXSYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLK
NNDLRSRQELTAHLTNQWPSPGALDVNAVALDTLLYRKHNKQWYEKSYHSLDQLSSEVSL
SQTSLGPGHSQEGDGKHDALHLISEGKEDTPSLLGLCGSLTSVASYKSLTSLKSNDCLAS
PTTDMTSPGLTPS
Download sequence
Identical sequences ENSSARP00000004347 ENSSARP00000004347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]