SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000004511 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000004511
Domain Number 1 Region: 54-113
Classification Level Classification E-value
Superfamily SH3-domain 1.02e-21
Family SH3-domain 0.00061
Further Details:      
 
Domain Number 2 Region: 206-244
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000302
Family SH3-domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000004511
Domain Number - Region: 509-580
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00759
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000004511   Gene: ENSSARG00000004947   Transcript: ENSSART00000004970
Sequence length 586
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6881:55251:127697:1 gene:ENSSARG00000004947 transcript:ENSSART00000004970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIKKETESKDDNLPIKRERHGNVASLVQRISTYGLPAGGIQPHPQTKSIKKKTKKRQCKV
LFEYSPQNEDELELKVGDIIDINEEVEEGWWNGTLNNKVGLFPSNFVKEIEITDDGEAHE
APEDSETALTGPTSPSLGNGSETTPGSVPQPKKIRGIGFGDIFKEGSVKLRTRTSSSEIE
EKKAEKPLIMSSLGSKTQNVEITKTDTESKLKAKEYCKTLFAYEGTNEDELTFKEGEIIH
LISKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPKKPLPPAKGPXXXXXXXXX
XXXXXXXXXXXXXEKSMLEPKPKPAAPQVPPKKPTPPTKANNLMRSPAIMYPKRPEKPVP
PPPPVAKVNGEVSAVPSKFENELVSKPKLDSEQLPLRPKSVDLDSFTLRSSKETXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXPSAYPSASSVTSKPNVTATINPLDTKVKGETDDKNLMHWNSPQMEELRAQVIEL
LCIVEALKRDHGKELEKLRQDLEEEKAMRSNLEVEIEKLKKTVLPS
Download sequence
Identical sequences ENSSARP00000004511 ENSSARP00000004511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]