SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000004688 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000004688
Domain Number 1 Region: 553-662
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0000638
Family Fibrinogen coiled-coil and central regions 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000004688
Domain Number - Region: 677-761
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00183
Family Myosin rod fragments 0.0078
Further Details:      
 
Domain Number - Region: 170-258
Classification Level Classification E-value
Superfamily Prefoldin 0.00549
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000004688   Gene: ENSSARG00000005139   Transcript: ENSSART00000005172
Sequence length 881
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2762:8025:102474:1 gene:ENSSARG00000005139 transcript:ENSSART00000005172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSAAKPWNPVIKAGSHVIERARPLPAASSGMKTSKSSTSLAFESRLSKLKRASSEDMLN
KPGCSSTSGGARLKKTPTSGAISELTESRLRSSSGVVATTKRTGIPAPRELAVTVSRERT
VPRGPSNPRKLVSSPTSSSTPTPIKHLRTASTRPKQENEGGEKAMLESQVRELLAEAKVK
DSEINRLRSELKKCKEKRSPNTEVTNTVNPNVGRTSFSSGDSESLVRALEEKNKNFQKEL
ADLEEENRVLKEKLTYLEHSPNSEPSHTGNSSCPTSAAQESSFGSPPGNQLSSEVEEFKK
NMHGNTLRKSGSSSSDVTKASLSPDVSDFEHISADTPSRPLSSTSNPFKSSRCSTTGSSP
NNVSELXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDDEAETTPLHLKLKDEHAKLNFPELERYKEFMPKHKDCKATLERLK
IENGSKHLENEKQNAGVTCPTGPVAEGCEVQEMLKLAQAEKDQLEQSCSELKQELVTANG
EINRVSNLLAKVEKDYSYLKDICDHQAEQLSRTSLKLQEKASESDAEIKDMKETIFELED
QVEQHRAVKLHNNQLISELESSVIKLEEQKSDLERQLKTLTKQIKEETEEWRRFQADLQT
AVVVANDIKCEAQQELRTVKRRLLEEEEKNARLQKELGDMQSLGRLVLSRDTPASEDSEP
SEVSAPGRWPGVYVSRTSPTPSESATTVKSLIKSFDLGRPGGAGQSISVHKTPRSPLSGI
PVRTAPAAAVSPMQRHSSYSGVRSTSKGLTQHLDLSDLPLS
Download sequence
Identical sequences ENSSARP00000004688 ENSSARP00000004688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]