SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000004869 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000004869
Domain Number 1 Region: 434-638,697-888
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-126
Family Motor proteins 0.000000000741
Further Details:      
 
Domain Number 2 Region: 137-191,230-363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-59
Family Motor proteins 0.000000381
Further Details:      
 
Domain Number 3 Region: 1290-1404
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000000000243
Family Myosin rod fragments 0.0021
Further Details:      
 
Domain Number 4 Region: 933-1001
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000654
Family Myosin rod fragments 0.0021
Further Details:      
 
Domain Number 5 Region: 1091-1205
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000034
Family Myosin rod fragments 0.0059
Further Details:      
 
Domain Number 6 Region: 1768-1879
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000759
Family Myosin rod fragments 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000004869
Domain Number - Region: 1519-1625
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number - Region: 1887-1974
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0301
Family Myosin rod fragments 0.014
Further Details:      
 
Domain Number - Region: 53-83
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0445
Family Myosin S1 fragment, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000004869   Gene: ENSSARG00000005265   Transcript: ENSSART00000005377
Sequence length 2020
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1439:1416:62609:1 gene:ENSSARG00000005265 transcript:ENSSART00000005377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAATMTVPGRKVPPRPGPVPEAAQPFLFTPRGPGLGGGPGGPGTSPQVEWTARRLVWVP
SELHGFEAAALREEGQEEAEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXTYSGLFCVVINPYKQLPIYTEAIVEMYRGKRHEVPPHVYAVTEG
AYRSMLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECS
FHIFYQLLEGAGEQLKGELLVEPYSNYRFLTNGPSCMPGQERELFHETLDSLRILGFLYD
EIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDL
IERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRQLRDQADFSVLHYA
GKXXXXXXXXXMKNMDPLNDSVAALLHQSTDRLTAEIWKDDLGGFQPFSLLGSLPPPEAT
GRRGPALSPVGVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTN
PSFVRCIVPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRXXXXX
XXXXXXXXXXXXXXXXXXIQALYLVPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVS
FQAAARGYLARRAFQKRQQQQSALRVMQRNCAAYLKLRHWQWWRLFTKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEEERSRLAEQLRAEAELCAEAEETRGR
LAARKQELEMVVSELEARVGEEEECSRQLQGEKKRLQQHIQXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXRLRKEEKNRQELEKLRRRLDGESSELQEQVAEQQRLLQELRAQMGRKEEEL
QASLVRVEEEGGARAQLLKAIREAQAGLAETQEDLEAERLARAKAEKQRRDLGEELEALK
SELEDTLDSTNAQQEMRSKREQEVMELKKALEEEARGREAAVQELRQRHGQALGELMEQL
EQARRGKATWDKARSALEAEVSELRAELGTLQTARQDGEQRRRRLESQLTEVQGRAGDVE
RARVEAAEKLQRVQVELESVNGALSEAESRAIRLSKELSSAEAQLRDSQEMLDEESRLKH
AAEARARALGAEATGLREQLEEEAAACERAERELTAQALLSEWRRRQEEEASAVEAGEEA
RRRAAREAETLAQRLAEKTEAAERLERGRRRLQQELDDATMDLEQQRQLVSSLEKKQRKF
DQLLAEEKAAVLRAVEERERVEAEGREREARALSLARALEEEQEAREELERQNRTLRAEM
EALLSSKDDVSKSVHELERARRVAEQVASDLRTQVTELEDELTAAEDAKLRLEVTIQALK
AQHERDLQARDEAGEERRRQLAKQLRDAEVERDEERKQRALAVAARKKVETELEELKAQM
DTAGQGKEEAVKQLRKMQALKELSREVKERSSREEIFALNKESEKGVKGLEAELVRMQEE
LAAADRARRQALQERDEMADEVASGSLSKAAILEEKRQLEGRLGQMEEELEEEQSNAELL
GDRYRKLLLQVESLTSELSAERSFSAKAESGRQQLERQIQELRERLGEEDAGARARQKMT
IASLESKLAQAEEQLEQETRERILSGKLVRRAEKRLKEVVLQVEEERRAADQLRDQLEKG
NLRMKQLKRQVEEAEEEASRAQAGRRRLQRELEDVTESAESMNREVVTLRNRLRRGPLTF
TTRTVREVFHLEEGVASDEEADGADPAPQEPEGSPAAQPQ
Download sequence
Identical sequences ENSSARP00000004869 ENSSARP00000004869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]