SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006674 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSARP00000006674
Domain Number - Region: 98-133
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000575
Family Myosin rod fragments 0.0082
Further Details:      
 
Domain Number - Region: 379-477
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0034
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006674   Gene: ENSSARG00000007356   Transcript: ENSSART00000007366
Sequence length 742
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3864:1968:61711:-1 gene:ENSSARG00000007356 transcript:ENSSART00000007366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYIFLNMNILWSLFNVLCDQEVAERAATRGLSHPAATCRRYRLSTPRRQSPTGSQAGPLG
SPVGRKKNYLPLHADMTSEFLEELKWDDGLSIPVANEENKILEDQLSKLQNEKSNLQHQL
QDYEDRIKAMSSHFKNVKQEFKFTQCLCKARENEIKSEEHFKAIAERELGRVKEEIQRLE
NETASIREKKTDKENAIFKATQKLDNLKCQMNWDQQALDAWLEESAHKDSDAFTIQKYAQ
QDDNKIRALTLQLERLNSEFGQKRKLLNDELTETLSAQLELDKAAQDFRKIHDERQELIK
QWENTIDQMQKRDQDIDQCALQLSNIKQELREKEILVKEKIKFLENEIGNNTEFERKIAA
ADRKVSKCRMEYQSHENSRVQLKDELDCLKATVNRSSSDLEALRKNISRIKRVTEDERAK
LENIKNHNEAIKKKLHEITERTMSVEEKATNLEDIVKKDEKTVKEVQDQLNILKAVLYKK
SQELQTEKMKEKATVSEIKGTRSLLRNLNNQLRKLDFDTLMQQEIMYNQDFYIQQLERRM
SRLKGEINSEEKLALETKIVELKKVLEEKKSTFDLLETQIGKLHNDLYFIKKSNAKNFDE
KQSLLTKINELNLFNDTSEKELKKVKTLKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEFHDRLSKIEKLKNRYEII
TVVMLPPEGEEEKTQAYYVIKV
Download sequence
Identical sequences ENSSARP00000006674 ENSSARP00000006674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]