SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008612 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSARP00000008612
Domain Number - Region: 907-1007
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.0068
Further Details:      
 
Domain Number - Region: 1059-1095
Classification Level Classification E-value
Superfamily Outer membrane lipoprotein 0.0334
Family Outer membrane lipoprotein 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008612   Gene: ENSSARG00000009456   Transcript: ENSSART00000009515
Sequence length 1174
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3738:24982:83452:1 gene:ENSSARG00000009456 transcript:ENSSART00000009515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPAMAEPRGPVDHGVQIRFITEPAGDAQMRTGRRPAKDARANTYGVAVRVQGIAGQLFVV
LNSGEKGSESFGVQIKGAHRQGPPGAPHSDLELPAEHSRPLAQENAGTWQGSVSDEELGD
PWRGRLLRSQSQASLLGPAPLGPGHRSTSLLELAPGSAGSAIDTAPLSSVDTLIHKFDRH
QGGQARGRTGRRMRALPAEQRKRSQSLDSRHLRDPPEDRRSPIPWAPPSRPGSAGSSKQP
AQAIPTSSYSRARQTQDWVLQNFEEPRTRAQDPAVLQFKSTPDLRDQQEAAPPGSVEHVK
AALYGILREGSSESDASVRRKVSLVLEQMQPLVMTTGSAKVLAGQGELAQKVEELQRKLD
EEVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRSELETQVMELQDQ
LKQGPVPAKEGLMKDLLETRELLEEVLEGKQRVEEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLGEKNEALQRELGQARAGDRGSRQVEEL
RKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEQIGEDSKQAL
HQLQSQLEDYKEKSRREVADAQRQAKEWASEAEKSSGGLSRLQDETQRLRQTLQASQADL
DTARLDKELLAQRLQGLEQEAEKKRRSQDDRTRQVKSLEEKVSRLEMELDEERNTVELLT
DRINRSRDQVDQLRTELMQERSARQDLECDKISLERQNKDLKGRLASLEGFQKPSASLSQ
LESQNRELQERLQAEDREKTVLQSTNRKLERRVKELSIQIDDERQHVNDQKDQLSLKVKA
LKRQVDEAEEEIERLDGLRKKAQRELEEQHEANEQLQARIRALEKDSWRKAARSAAESSL
QQEGLSSDEEFDGVYNPNSIASLLTESGLQTSSC
Download sequence
Identical sequences ENSSARP00000008612 ENSSARP00000008612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]