SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008664 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000008664
Domain Number 1 Region: 472-816
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.06e-112
Family Rap/Ran-GAP 0.000000568
Further Details:      
 
Domain Number 2 Region: 944-1020
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000132
Family PDZ domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000008664
Domain Number - Region: 1648-1696
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0968
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008664   Gene: ENSSARG00000009575   Transcript: ENSSART00000009582
Sequence length 1718
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2176:16799:239064:-1 gene:ENSSARG00000009575 transcript:ENSSART00000009582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPRQSQEEKHKLGRTSSKFKEPSRIMQSDDYFARKFKGMNGNMAPATSLNPSNSSESG
GPANGTPAMPKMGVRARVSEWPPKKDCSKELACKTLWESQSQASYESVASILHNGQNDQS
DGQQEEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDVTISDIDAEDVLDQNAVNP
NTGAALHREYGSTSSIDRQGLSGENIFAMLRGYRAESYDHKTMALFGFPEFFPCDPAISP
SLHAAAQISRGEFVRISGDYMDSALLMGRDRDKPFKRRLKSESVETSLFRKLRTVKSEHE
TFKFTSDLEESHLDRGIRPWNCQRCFAHYDVQSILFNINEAMATRANVGKRKNITTGASA
ASQTQMPAGQMGNCESPLGSKEDLNSKENLDADEGDGKSNDLVLSCPYFRNETGGEGDRR
IALSRANSSSFSSGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEHIDLG
AYYYRKFFYGKEHQNYFGIDENLGPVAISIRREKVEDAKEKEGSQFNYRVAFRTSELTTL
RGAILEDAIPSTARHGTTRGLPLKEVLEYVIPELSIQCLRQALNSPKVSEQLLKLDEQGL
SFQHKIGILYCAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDNKTDST
GTHSLYTTYKDYELMFHVSTMLPHMPNNRQQLLRKRHIGNDIVTIVFQEPGALPFTPKNI
RSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDFLLAKV
INAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTATVDTSVKFSFITLGAKKKEKVKPR
KDAHLFSVGAIMWHVIARDFGQSADIECLLGISNEFIMLIEKDSKNVVFNCSCRDVIGWT
SGLISIKVFYERGECILLSSVDSCAEDVREIVQRLGIVTRGCETVEMTLRRNGLGQLGFH
VNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSMTVKVVIIQP
HDDGSPRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXCQSPLLLEHQGSGPLECEGAREREDSMEGSRHSETKWHGPPSKVLSSYKERAMQKDGS
CKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIKGASTD
SGIDTTPCMSTTVLGPMHLTGSRSMIHSRAEQWADSADISGPDDEQAKMYTVHSYTPTLS
ASNTADSSMGDLSEISSHSSGSHHSGSPSVHCSKNNGSLDTSTVYIVSHSSGPQVPGSTS
KSYHRQGSVNKYVIGWKKSEGSPPPEEPEVTECQGLYSEMDLMPMAAQHQTVVGDTVSET
QHVLSKEDFLKLMLPDSPLAEEGKRKFSFYGNLSPRRSLYRTFSDESICSNRRGSSFGSS
RSSMLDQALPNDILFSTTPPYHSTLPPRTHPAPSMGSLRNEFWFSDGSLSDKSKCAEPGL
MPLPDTATGLDWSHLVDAARAFEGLDSDEELGLLCHHPSYLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXERSPSTLTGKVNQLELILRQLQTDLRKEKQDKAVLQA
EVQHLRQDNMRLQEESQTATAQLRKFTEWFFSTIDKKS
Download sequence
Identical sequences ENSSARP00000008664 ENSSARP00000008664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]