SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008889 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSARP00000008889
Domain Number - Region: 123-224
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0246
Family Myosin rod fragments 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008889   Gene: ENSSARG00000009838   Transcript: ENSSART00000009829
Sequence length 231
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3324:185:2278:-1 gene:ENSSARG00000009838 transcript:ENSSART00000009829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESITYADLRFVKAPLKNEVCQLDEVPAVVDEDGDLTYENVQVCPAPGALASLASSGPG
DKAXXXXXXXXXXXXXXXXXXXXXXXXXRAICTKYVLLGLLLSCLLLGVAAIGLGVRYLQ
VSQQLQRAHRNLESTNSSLGQRLHQAEAKLKQQAEELQGARLELTQREESLHKVQQVGQD
TQRQLDDCAGSRKTKDTLRSEQEQRSNLEQRLKSMESMRDKLRQLFTCTSP
Download sequence
Identical sequences ENSSARP00000008889 ENSSARP00000008889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]