SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009012 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009012
Domain Number 1 Region: 1415-1484
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000236
Family SH3-domain 0.0029
Further Details:      
 
Domain Number 2 Region: 981-1154
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000222
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009012   Gene: ENSSARG00000009947   Transcript: ENSSART00000009964
Sequence length 1494
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6978:136691:163734:1 gene:ENSSARG00000009947 transcript:ENSSART00000009964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPPKLSGETLIVHHIPLVHCQVPDRQCCGGASGTSGGTRPHPLCPPELGGPQTDQDLG
QADSLLYSSLRSAPGGTTRSADSAKSRARDGRGTGGPRRHNPFLLQEGVAEPGLDDLYDD
SMADGDPQQSFHLHETGQHTFHLSSFQLPPSGPRVVRPWGATHSRTGVVEGQEQEPVATL
NAQRCSTNHCCQPELDTETMELDECGGPGGSGSGGGASDTSGFFEQEWKLSSDESPRNPR
YSGSGPQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHGSSRANLNS
APQSCSDSSFCSHSDPGAFYLDLQPSPAESKMSCESHHPDSGEREGSYGCPHASSPELDA
NCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSCS
EEHTKISPPPGPGPAPAPDPNQPSEYYLFQKPEAQSEDQEAVGSTAEAAAPVSPTVIEGQ
VYTNTSPPNLSTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPATLAGPGSPPR
RVTSFAELAKGRKKAAGSGSPPLRVSIGDSSQEFSPIQENHQDKVGPLNEGTHCSHSLPP
MPLGPGLDLVSQDLWAIQVCQGPQSNEMPSALRAAGQDTLGQLLEPEAFPGSPANSHTQR
DARARADGGGAESRPVLRYSKEQRPTTLPIQLFVFQHHFPKQLAKAWALHSLSQLYSLSG
CNRAQQPAPPAAQPALATSELLAPARLGARKAGPEPETSRPSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLTEYRLHGPGS
LPPLGAWRSTLGRAESLARAGGEGSMASRPSNANHLSPQALKWREYRRKNPLGPPGLSGS
LDRRPQEARLARRNPIFEFPGSLSSGHLNCRLNGQIGKPLPLTCPDFQDPFSLTEKPPAE
FCLSPDGNSEAVSIDLLQKKGLVKAVNTAVDLIVAHFGTSRDPGVKAKLGNSSVSPNVGH
LVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGPSTKVLHGLYNKVSQ
FPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWGFLSATHTVCPGLFE
ELLLLLQPLALLPFSLDLLFQHRLLQSGRQQQQRKELLRESQDLLLSAHSTLQLTRARGQ
EGPGDMDRAGDGERVKGVGAPEGGEDEEEEEAEEAAAAAGSSGRGRGARGGQTGWWYQLM
QSSQVYIEGSAEGSRFPRGGSSSEKKKGTGGGGPPPREGVVEGAEACPAPEEPLVRDRGW
PFWMGSPPDSVLAELRRSRDREGPPAPPTGNEEGASEPSPGGIKWGHLFGSRKAQRETRP
TNXXXXXXXXXXXXXXXXXXXTVGAFRKPEPKECPQEPHSPAPPAKPCEMKALCHHLATG
PGQLSFHKGDVLRVLGPAGGDWLRCSRGPDTGLVPLAYVTLTPTPSPTSGSSQN
Download sequence
Identical sequences ENSSARP00000009012 ENSSARP00000009012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]