SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009095 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009095
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily RUN domain-like 2.88e-37
Family RUN domain 0.00068
Further Details:      
 
Domain Number 2 Region: 1327-1373
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.000000732
Family Supernatant protein factor (SPF), C-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000009095
Domain Number - Region: 943-1038
Classification Level Classification E-value
Superfamily Tropomyosin 0.00347
Family Tropomyosin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009095   Gene: ENSSARG00000010062   Transcript: ENSSART00000010056
Sequence length 1381
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_4972:4955:44718:-1 gene:ENSSARG00000010062 transcript:ENSSART00000010056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVTELSNEFKEIGEPITDDSTSLHKFSYKLEYLLQFDQKEKATLLGTRKDYWDYFCACLA
KVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTSDWYYARS
PFLKPKASSDIVGHLYELTDVQFDLASRGYDLDAAWPTFARRTLTPGSSAYLWKPPSRSS
SMSSLVSSYLQTQDMAASFDLNSSLNNEAMEGFDEMRVELDQLELREKQLQERIQQLERE
NQELRATTRLQEEQLREEKERGRVAAENSTHLPYVLAELQKQWEVTQATQSTVQELQGCL
QALEQGAAEKEEDYQSALQRLEALLRPLARELEATQDSLGRKNQHLTSIQGQPGTAERKV
DTAPEPKGSPELTPSSAALEEKLRALEGENAQIRELSRQQDARLEQLLQELQLKEEARAR
LEGRVEELSPLREELLRERQQVAQLQQELRESVSRALSLQAELQDARREEQGLRDEKALL
EQETRSLTRQLPLLEAQLAQVSQHVSDLEEQKKRLIQDKDHLVQKVGMWERHPDQREAPG
PRDSAQPRASLKLEEAPGDPQGGRAGEAQTAGGRQEEKLPQSTAELEQELQRVLERNQLL
EGKLQALQAEYQALQQREASIQGSVASLEAEQANIRHMGDQMEASLLAVRKTKETMRARV
AEKDAALQSKEAECQQLREQAEESRRLAQARAEEIQALQSQCQRQTQLLETRPAAKDPQG
LGPPQDSGSSELAGQLALSQAQVEVHQGEAQRLQAKVADLQCRLQATLGDQEKVQSQLIF
ADAALRDHDLVQQLKEQIEALISAHVQELLQCSEREGALQEENFGEARQRDQDLEALQEL
LAQAKCSSQEAEAEHVELQEQLHRANTDTAELGIQVCALTAEKERVEGTLARTVQELQDT
KEAACRERQALECQVASLQLEKESLQEKLGAAQEAASSLPGLQAQLAQAEQQVQSLQEAA
RQEHDTLKFLMSTEIMDSQSKLKTANEQCKSLQDQLEKQAQKLQPAEEAVEKLKAAQEDM
GEKLSHASSRLSECQAAMLKKDEEGAALQESLSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKLPLTVDE
ITNFGESNRELFVRSSTYSLIPITVTEAGLTISWVFSSDPKSISFSVVFQETEDTPLDQC
K
Download sequence
Identical sequences ENSSARP00000009095 ENSSARP00000009095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]