SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009642 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009642
Domain Number 1 Region: 763-867
Classification Level Classification E-value
Superfamily PH domain-like 5.77e-20
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 2 Region: 4-93
Classification Level Classification E-value
Superfamily RUN domain-like 0.00000000085
Family RUN domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009642   Gene: ENSSARG00000010662   Transcript: ENSSART00000010673
Sequence length 969
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2123:248837:336444:1 gene:ENSSARG00000010662 transcript:ENSSART00000010673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPREVKDRILENISQAVKKLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDL
SSGYWVLVVHFTRKEAVKQIEVLQHVATNLGRXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXNALVCSHDHLTLFLTLVSGLXXXXXXXXXDAYLDLPYMDYYKPQYLDFEDRLPS
SVHGSDSLSLNSFNSATSTVEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWEDGDLTDTV
SGPRSTASDLTSGKASTKSPTQRHNPFNEGQADTVSSSDTTPVHAASQEKAEPHTPSPPD
ACTELEVIRVSKKKKTGKKKIRVDEEASPLHPSSSSSQRRARQQEGPGVGRGSPDAPSAS
HRDEAAGPGSTAESSEPPEPGPMGLLIPAMKDTSMESLGQPLSKVIAQLNGQLDPSTWGP
HAEPPDQSFRTGSPGEAPEQPPSCDFSEGLPAPMDFYRFTVESPGSVAASGGHHDPAGPG
QPPHVPGGPAAAGPEEEGGGGGGGAQPPPPPLDDPSGAGPEPDTRELDPSPLPPVGEGPV
GPGTQTQLTREQPSPCLSSAEDSGVEEGQGSPSEVTHAAEFRVDNNHLLLLMIHVFRENE
EQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKPYLVEEAISYNELDYVSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXATAVTVCFYGLVHWEDPTDECMGPAACHCAAPEGGITKEGVLHYKAGTS
YLGKEHWKPCFVVLSNGILYQYPDRTDVTPLLSVNMGGEQCGGCRRSNTTDRPHAFQVIL
SDRPCLELSAGSEAEMADWMQHLCQAVSKGAIPQGVAPSPCIPCCLVVTADRLFTCHEDC
QTSFFRSLGTARLADISTVSTDPGREYCVLDFSQDSQQPLPPWVLYLSCTAELDRFLSTL
NMGWKIIYQ
Download sequence
Identical sequences ENSSARP00000009642 ENSSARP00000009642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]