SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010880 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010880
Domain Number 1 Region: 45-137,181-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-49
Family Motor proteins 0.000000309
Further Details:      
 
Domain Number 2 Region: 776-840
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000602
Family Myosin rod fragments 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010880   Gene: ENSSARG00000011965   Transcript: ENSSART00000012045
Sequence length 1575
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_1996:50174:280619:-1 gene:ENSSARG00000011965 transcript:ENSSART00000012045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NESFLTFRTTFRGITWRKKVSSDLGEVTTLPQKNAELHLSQTVASSCNYWVIYTYLDLFS
VSINPYKWLPVYQKEVVAGYKGKRRSEALFYIVTNNAFKDTLHTLENCTGGIKTVSTKQI
MQSLTASINARRKILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLLEKSKMIFQQSGKKYHIFYQILSGRKLHDTLLISVNPREFHFCSGVVSVDN
LGDAEGFLTTNQVMDILNFLSEEKNVYLTGAIIHFGNMKFKKPREEQVEADGTEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTYTVGVLPNSVCKRIFKLVAHNRAL
DAKVSRKFIDILDITHFEILVNIILELNFMKLQRPLNNTYTLKEEHRKEDIDCLCLDIDL
DFQACIDLIEGPGGILSILKKGCTFLNTTEVTFKTKLTDNHFEKSVLKPKSDQKKNLHFK
FPRYAGAEPHNLSGWHEKNKDLLNIVVVEYQKSSNLLAKLFENDIIPDSXXXXXXXXXXX
XXXXXXXXXXXXEIKLMTNLKSIVPYFVGCMNPNANKIAGIMDPYQLHNGVEGIRTHCEY
ADFKQRCYILNLRIFQKSKSGINTAELFVSEINHICCFGILRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQETLAN
VEEQCLLIKSKIQLEAKVKTQSEQGEEEEEINSELTARGRKLEDECSELRKEIDDLETVL
VKSEKEKRAAELGVKNLTEEVKTENTRELSRAIRVVQAHQLTLEKVSDLHKAKMKLEQPV
FVPEDALRSEKHARMCQTETYKLKADLLDLSMENLESWLPAEKMRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXIQIQDLQEEQEARSTQANVERGRADITQNNLEEAAGLSWDQLEI
TEQETKFPKPHQHMEKTTLLTNAKKLCTLCEECFNDPNIKLDEVTFENGLAAQEIKLCSE
SXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQSALVQTLQPSKQHDVLL
EQHEIDQEAKAWALSRGNVKGEQWRTCRVDANQRTENSDDXXXXXXXXXXXXXXXXXXXE
NKTKQIEQEKPKDQITLEKAEGALEHNKNKILHSQLVLLKAKRLERKVSEIYEAKENVXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXHLELRQMAVSAWLCSLLQSELEELAVQEQTRHLVEDELQEVTKRISLFTHNTSLLRR
KQKLGPDVAWLQNFEEAVQGSQNAEKAKKAASEAADMSEELKTVHNVNAHMERIRNNTDV
ATKDEKILDEADRCDLMHRKIQKLEPSTCELDSLEGESFHSVGDHGCRCMGELTYPAEED
KKTLSRLHTLMDKLQLKEQIYKQQMEAEAEANQYFSKEQQQHELNEAKEMAKIAESQVNR
LKIKAKEFGKKVCAE
Download sequence
Identical sequences ENSSARP00000010880 ENSSARP00000010880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]