SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001053 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001053
Domain Number 1 Region: 2086-2157
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 2 Region: 1883-2009
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.43e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 3 Region: 988-1084
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.57e-16
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 4 Region: 2164-2289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.62e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 208-293
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.4e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1353-1485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 1194-1323
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-16
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 752-894
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.81e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 9 Region: 1562-1635
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000196
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 10 Region: 1725-1819
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000392
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 11 Region: 2521-2643
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 12 Region: 1066-1193
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000926
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 13 Region: 1641-1696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.00064
Further Details:      
 
Domain Number 14 Region: 942-991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000529
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 15 Region: 248-359
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000126
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 16 Region: 2047-2100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000715
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 1519-1566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.00059
Further Details:      
 
Domain Number 18 Region: 1805-1855
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000213
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 19 Region: 1482-1530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000534
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 20 Region: 2479-2526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000804
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 21 Region: 2278-2328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.024
Further Details:      
 
Domain Number 22 Region: 2001-2044
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000239
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 23 Region: 1685-1726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000925
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 24 Region: 1311-1358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000271
Family EGF-type module 0.01
Further Details:      
 
Domain Number 25 Region: 1843-1881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000749
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000001053
Domain Number - Region: 2817-2863
Classification Level Classification E-value
Superfamily Cadherin-like 0.0251
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 179-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0978
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001053   Gene: ENSSARG00000001107   Transcript: ENSSART00000001147
Sequence length 2902
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3494:48999:396211:-1 gene:ENSSARG00000001107 transcript:ENSSART00000001147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRRLCLLYFVWLGCVALWAQGTAGQPPPPPPKPPRPQPQPQQVPAAAAGSEGGFAAP
EYREEGAVVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGD
GFCSRPNMCTCSSGQISPACGSKSIQQCSVRCMNGGTCAEDHCQCQKGYIGTYCGQPVCE
NGCQNGGRCIGPNRCACVYGFTAPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCCA
TIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFEC
KCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCICPRGYITSTDGSRCIXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEYRRLCMDGL
PIGGIPGSAGSRPGGNGFAPSANGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGGQGPI
ITGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXEFHGLCSSGVGITVDGRDINECALDPDICANGIC
ENLRGSYRCNCNSGYEPDASGRNCVDIDECLVNRLLCDNGLCRNTPGSYSCTCPHGYVFR
TETETCEDINECSNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDLRRMCWLNIQNNC
CEVNINXXXXXXXXXXXXXXXXXXXXXXXXXXTACHRGFARIKGVTCEDVNECEVFPGVC
PNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECVHPVPGKFRMDACC
CAVGAAWGTECEECPKPGTKEYEALPRGPGXXXXXXXXXXXXXXXXINECKAFPGMCTYG
KCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFECECFEGYE
SGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPRGHELSPSREDCVDVNECSLS
DNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECS
CSDGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDMKTCIDVN
ECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDMHASCLNV
PGSFRCSCREGWVGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTGDGFTC
SDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICVFGTCN
NLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDFQLNPT
GVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCPPVNST
EYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYYLSEET
RICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYRSYNGT
TCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTXXXXXXXXXXXXXXXXXXXXXXX
XIDECKEIPGICANGVCINQIGSFRCECPTGFSYNDLLLVCEDIDECSNGDNLCQRNADC
INSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQ
DQTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRN
GRCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGY
EVKSENCIDINECDEDRNICLFGPCTNTPGGFQCICPPGFVLSDNGRRCFDTRQSFCFTN
FENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHD
TREDVNECLESPGICSNGQCINTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGT
CTNVIGSFECNCNEGFEPGPMMNYINECAQNPLLCAFRCMNTFGSYECTCPIGYALREDQ
KMCKDLDECAEGLHDCESRGMMCKNLIGTFMCLCPPGMTRRPDGEGCVXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRQGLCFAEVLQTMCQMASSSRNLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDKCKGLPNLCTNGQSINTL
ASFRVSKVGYTIDISGTSWVDLDECSQSPKPCNFICKNTEGSYQCSCPRYVLQEDGKTCK
DLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGICQNT
PGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYVQHYQWNQ
CVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXHCVSGMGFNKGQYLPPLETEVDEENALSPEACYECKINGY
PKKDSRQKRSVQTPELSAGEEVSLESVDMDSPVQMKFNLSGFGSKEHILELMPAIEPLNN
HIRYVISQGNNDGFFRIHQRQGLSYLHTAKRKLVPGTYTLEIMSVPLYKKKELKKLEDSN
EDDYLLGELGEALRMKLQIQLY
Download sequence
Identical sequences ENSSARP00000001053 ENSSARP00000001053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]