SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001139 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001139
Domain Number 1 Region: 392-535
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-39
Family Third domain of FERM 0.00000398
Further Details:      
 
Domain Number 2 Region: 288-393
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-36
Family Second domain of FERM 0.000000859
Further Details:      
 
Domain Number 3 Region: 207-287
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.43e-25
Family First domain of FERM 0.00000773
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001139   Gene: ENSSARG00000001236   Transcript: ENSSART00000001244
Sequence length 861
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_4639:94762:211454:1 gene:ENSSARG00000001236 transcript:ENSSART00000001244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSPHQQQKDEGEGATNXXXXXXXXXXXSQAAEGENQCEQKLKTNGGTP
TQEDLIRNKERTPESRGLSRLFSSLLKRPKSQVSEEEGREVEPSKEKGEGGQTEIELGTC
LDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEEPREDPDLETKEGLEECSKID
VKEESQETKAERDLKASQKSIRRHRNMHCKISLLDDTVYECVVEKHAKGQDLLKRVCEHL
NLLEEDYFGLAIWDNTTSKTWLDSAKEIKKQVRGIPWNFTFNVKFYPPDPAQLTEDITRY
YLCLQLRQDIVSGRLPCSFATLALLGSYTIQSELGDYDPELHGVDYVSDFKLAPNQTKEL
EEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLHKAKDLEGVDIILGVCSSGLLVY
KDKLRINRFPWPKVLKISYKRSSFFIKIRPGEQEQYESTIGFKLPSYRAAKKLWKVCVEH
HTFFRLTSTDTIPKSKFLALGSKFRYSGRTQAQTRQASALIDRPAPHFERTASKRASRSL
DGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKRERLDGENIYIRH
SNLMLEDLDKSQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQI
PTGEGPPLVKTQTVTISDPANAVKSEIPTKDVPIVHTETKTITYEAAQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTVKGGISETRIEKRIVITGDADLDHDQVLVQAIKEAKE
QHPDMSVTKVVVHQETEISEE
Download sequence
Identical sequences ENSSARP00000001139 ENSSARP00000001139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]