SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000001301 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000001301
Domain Number 1 Region: 68-154
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.28e-31
Family SCAN domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-23
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 3 Region: 466-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 189-247
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 5 Region: 388-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.71e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000001301   Gene: ENSSARG00000001423   Transcript: ENSSART00000001427
Sequence length 534
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6532:32421:38320:1 gene:ENSSARG00000001423 transcript:ENSSART00000001427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPETLLDFQSDLPHAENPLMKIKVVEVLTLNEEVARTRNAQIRALYAENEGFSSDLREPT
QQQSQCPVDSSAVRQKFRGFRFEEAAGPRELAQLRELCHQWLQPEMRSKEQILELLVLEQ
FLAALPQKLRVWVESQHPESCQAAVALVEDVTWVSEEEALPTQGSTCSLDVTAHKEKDKD
MTAQLEKALPEDSVTFQDVAVDFSREEWGLLDLTQRTEYHDVMLETFGHLVSVGWNTTLE
NKQLTSESSIPEQEPSPELTMEVVSQKEAQPSTSRDSPRVGTAKVSKSALKRVKPTQEKT
LPKKHCQNLRSQANSTSDKSHVSLPKSLPKKNLRKRVSQVKNVKQTPFVKIHQKSCREEK
ARESSGKIFIRNPQQITFTRIRKGSQVCRCSACGKIFRNPRYFSVHKKIHTGERPYVCQN
CGKAFVQSSSLTQHMRVHTGERPFECQECGRTFNDRSAISQHLRTHTGAKPYICRVCGKA
FRQSSHLIRHRRTHTGERPYKCTRCGKAFTQSSHLIGHQKTHSKAKLKKKRTAL
Download sequence
Identical sequences ENSSARP00000001301 ENSSARP00000001301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]