SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000002663 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000002663
Domain Number 1 Region: 31-179
Classification Level Classification E-value
Superfamily C-type lectin-like 8.42e-20
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 2 Region: 283-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 3 Region: 417-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000225
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000002663   Gene: ENSSARG00000002968   Transcript: ENSSART00000002940
Sequence length 647
Comment pep:known_by_projection scaffold:COMMON_SHREW1:scaffold_146029:6858:9054:1 gene:ENSSARG00000002968 transcript:ENSSART00000002940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSLLLLLLLLVQPWAGTSADKEAVVCAEAACYTAHWGKLTAAQAQDHCSQNGGNLASV
RNEEEARHIQQALGQLLKSEALLETRIGKFWIGLQREKGKCLDPDLPLKGFSWLGGGAHT
DYTNWHKELRGSCVSKRCVSLLLDLSLPPQASRLPKWSEGPCGSPGSPGSNIEGFVCKFS
FKGMCRPLTLGGPGHVNYTTPFQTTSSNLEAVPFASVANVVCGDEDSENVLSYFICKEKE
PDVFHWGNSGPLCVSSKYGCNFNNGGCQQDCFEGGDGSFRCGCRPGFRLLDDLVTCASRN
PCSSNPCRGKATCRPEPHGENYMCLCPEGYQLDFSQRDCVDVNECESGSSCSQECINTLG
SFQCHCWIGYEPIDIEHVTCEDVDECATNNSLCIQGCVNTEGSFYCTCQEGYVQGNDSQQ
CVDVDECTSPEATQKCDSLCINTQGSFHCACHPGWELASDGFSCKMISVSPGLLAGTSQD
MGGRDSSSVPSAMVFSSTKDPELTSTVAPSTTKLSLPPRVHTTSAAPETLTHTGLPDFWM
EPNSHDPTAIPGHEEPTGGDVVAKHSDEEGTDGQKLLLFYILGSVVAILLLLALALGLLV
YRKRRARREEIKEKKPQSATDTYSWVPERPEKRAKENQYSPTPGRDC
Download sequence
Identical sequences ENSSARP00000002663 ENSSARP00000002663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]