SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000002878 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000002878
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.42e-35
Family SCAN domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.21e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 211-258
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-19
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 8 Region: 702-762
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.98e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 9 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-16
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 10 Region: 752-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000172
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000002878   Gene: ENSSARG00000003181   Transcript: ENSSART00000003178
Sequence length 802
Comment pep:novel genescaffold:COMMON_SHREW1:GeneScaffold_3850:28900:38331:1 gene:ENSSARG00000003181 transcript:ENSSART00000003178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTREIWPHNALRQEGLIKGKDDTWKWGTSFQGNSSSVWETSHLHFRRLRYHDTSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGNGEEAVALVEEL
QKDLDGPTLKLPGIIRDQDSLQEGMGSPGAALWQTPNDSHFPAEICPNRLTDPVVSNLQE
PLHDPPASEASAPSQEENPRNQLMALMLLTAHPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXKFYKCDICCKHFNRVSHLINHRKIHTGEKPYKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRQSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFNSKSSLVDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFVMSKS
FMVHQKLHTQEKAYKCVDCGKAFSYNSSLLVHRRIHTGEKPFESIECGRAFSSNRNLIEH
KRIHSGENTYECNEGKCFIKKS
Download sequence
Identical sequences ENSSARP00000002878 ENSSARP00000002878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]