SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003028 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003028
Domain Number 1 Region: 299-441
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 195-300
Classification Level Classification E-value
Superfamily Second domain of FERM 8.9e-37
Family Second domain of FERM 0.0000031
Further Details:      
 
Domain Number 3 Region: 131-195
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000744
Family First domain of FERM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003028   Gene: ENSSARG00000003304   Transcript: ENSSART00000003341
Sequence length 1092
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_765:25639:121100:-1 gene:ENSSARG00000003304 transcript:ENSSART00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKQEQDAEPQEAAGAQGREGAQPNPGPELSGEEQRQALEQFEAAAAAHST
PVRKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXKRSRGQVLFDKVCEHLNLLEKDYFGLTYKDAENQKXXXXXXXXXXXXXX
XGAWHFSFNVKFYPPDPSQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSE
LGDYDPDECGNDYISEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMY
GVDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEF
EQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQT
RRASALIDRPAPYFERSSSKRYTMSRSLDGEVGTGQYATTTKGISQTNLITTVTPEKKAE
EERDEEEERRKKAEEATPVAAIRQEGKSSGLGTDSCPLSPPSAHLAPPSPTELRRRWKEN
GQQVLGCELPKEPKPKPGEPTLDSDSKGKPYLGDQDVAFSYSPQAGKGTTLFSFSLQLPD
SFPSLLDDDGYLLFPHLKTNLLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDSERTDTAADGETTATESDQEEDAE
AKAQELDKAQDDLVKHQTNISELKRTFLESSTDTAITNEWEKRLSTSPVRLAARQEEAPM
IEPLVPEETKQSSGEKLMDGSEIFSLLESAKKPTEFIGGVTSTSQSWVQKMETRTESREL
ETEARPSVEEKVVQETVSEKRHVMNVHARGDASFVAGDDVAAAAQAVSADAFSTKGKEGS
SLTEGAKEKKGEGTDKAVLEQEESATASHEREEEQSTTTRVSETVEQKPHFESSTVKTET
MSFSSVSPGGVKLEISSKELPVVHTETKTITYESSQVDSGADLEPGVLMSAQTITSETTS
TTTTTHITKTVKGGISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVH
KETEITPEDGED
Download sequence
Identical sequences ENSSARP00000003028 ENSSARP00000003028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]