SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000003648 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000003648
Domain Number 1 Region: 99-260
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.48e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0059
Further Details:      
 
Domain Number 2 Region: 240-355
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.4e-23
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 508-570
Classification Level Classification E-value
Superfamily SH3-domain 3.41e-19
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 4 Region: 589-621,655-743
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000314
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000003648   Gene: ENSSARG00000004005   Transcript: ENSSART00000004022
Sequence length 775
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_1075:1149:8664:1 gene:ENSSARG00000004005 transcript:ENSSART00000004022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHIPSATGPFSALTPSMWPQEILAKYTQKEEPVEKPEFYYDEFGFRMDKEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPCSEKLRSLVLAAIPHSMRPQ
LWMRLSGALQKKRSSELSYREAVKNSSNDETIAAKQIEKDLLRTMPSNACFANVSSIGVP
RLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLL
GVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVHIRLLLRLWDLFF
YEGSLVLFQTTLGMLRLKEDELIQSENSASIFNTLSDIPAQMEDAELLLGEAMRLAGSLT
DMAVETQRRKHLAYLMADQGQLLGTSATTNLSQVVRRRTQRRKSGITSLLFGEDDLEALK
AKNIKQTELVADLREAILRVARHFQCTDPKNGSVVSLQCQPSRPHRGLIGLPAPVGTCSL
GQELTPDYSMESHQRDHENYVACSRSHRRRAKALLDFERHDDDELGFRKNDIITIVSQND
EHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDTVTEGVTDLVRGTLCPALKALFEH
GLKKPSLLGGACHPWMFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKVLTPEELLYR
AVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLQTVEKWYQPWSFLRSP
GWVQIKCELRVLCCFAFSLSQDWELPAKREEKQPLKEGVQDMLVKHHLFSWDIDG
Download sequence
Identical sequences ENSSARP00000003648 ENSSARP00000003648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]