SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000005478 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000005478
Domain Number 1 Region: 80-166
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.55e-19
Family First domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 166-266
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-18
Family Second domain of FERM 0.0032
Further Details:      
 
Domain Number 3 Region: 304-420
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000615
Family Third domain of FERM 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000005478   Gene: ENSSARG00000006003   Transcript: ENSSART00000006043
Sequence length 1049
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3848:78194:336382:-1 gene:ENSSARG00000006003 transcript:ENSSART00000006043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEPGRAGRCGRGCSRGTRREAGGMASVFMCGVEDLLFSGSRFVWNLTVSTLRRWYTERLR
ACHQVLRTWCGLRDVYQMTEGRHCQVHLLDERRLELLVQPKLLSRELLDLVASHFNLKEK
EYFGITFTDDIGQQNWLQLDHRVLDHDLPKKPGPTILHFAVRFYIESISFLKDKTTVELF
FLNAKSCVHKGQIEVDSETIFKLAALVLQDENARKDLKTLPAFPTKTLQEHPSLAYCEDR
VIEHYLKIKGLTRGQAVVRYMKIVEALPTYGVHYYAVKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKS
IWVMAISQHQFYLDRKQSKAKIPSARSLDDIAMDLTETGTPRVSKLVTLEAKSQFIMASN
GSLISSGSQDSEISEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKIPKE
YPLNIGEKPPQVRRRVGTTFKLDDNLLPSEADPALQELESNFLIHQKLVEAAKKLANEPD
LCKTVRKKRKQDYTDAVKKLQEIENSINEYRIRCGKKPNQKGTVILPEDIIPSENSSLSD
TTTYDDSNDAFTLAGQRSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTKQSREMLS
THSSPYRTLERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSE
MDNDKPFFSLSKSQRSSSTEILDDGSSYTSQSSTEYYCMTPVAGPYYTTQTLDTRARGRR
RSKKQNASTSNSGSMPNLAQKDSLRNGVYSKNQEQPSSSYYIAGYAPYAEYDLYYSGGYV
YENDTEGQYTVNPSYRSSTHYGYDRQRDYSRSFHEDEVDRAPHNPYATLRLPRKAAAKSE
HITKNIHKALVAEHLRGWYQRASGQKDPSHSPQTSFDSDRGSQRCLGFAGLQVPCSPSSR
ASSYSSVSSTNASGNWRTQLTVGLSDYETPAHSYTSCYGNIYNPLPSPGRQYTETSQQDS
TDGHALADTLETCEHTLFCHEDSTPRTLV
Download sequence
Identical sequences ENSSARP00000005478 ENSSARP00000005478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]