SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006869 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006869
Domain Number 1 Region: 2-171
Classification Level Classification E-value
Superfamily RUN domain-like 4.32e-38
Family RUN domain 0.00073
Further Details:      
 
Domain Number 2 Region: 499-610
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000348
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 3 Region: 654-753
Classification Level Classification E-value
Superfamily PH domain-like 0.00000147
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006869   Gene: ENSSARG00000007586   Transcript: ENSSART00000007579
Sequence length 850
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3632:1022:56892:-1 gene:ENSSARG00000007586 transcript:ENSSART00000007579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIKKRLVGSVKALQKQFVSWDTVVTSEEADANTVYSALEAMFIHGLHTKHIRAEAGSKRK
KRTQQKPLPQPAFWPLLKAVTHRHTISELEHLIFVSTDVGRCRAWLRLALNDGLMECYLK
LLLQEQARLCEYYQPTALLRDAEEGEFLLSLLQGLTSLSFDLSYKSAILNEWTLTPLALS
GLCSFPELDLLTTSGTELQRKESLDSISHSSGSEDIEVHHSGHKIHRDRKLTASSLSLDT
ASSSQLSCSLNSDSCLLQENGSKSPDRSEEPMSCDSDLGTXXXXXXXXXXXXVLSEFSKA
QMDSVPTCQLNQEAQALCRPVCNSTRPHSATSVQPLPAPALSRAPPDSDPGTCHHPELPL
SARSSPCQQPSSLVGELTSAACEWSSQPEPREDGAGLSIVIPSPTSPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLSNPFRGLMKLGAVERRGPVGMWKELFCELSPLELRLLASHE
ERMCVESFSLLRCEAVGPALSDGRFELVFSGKKLTLRASSQDEAEDWLDRVREALQKCRP
QQEDEWVTIQSSDLPDDAPEAPPAGAPSHSDLPLEPEGPQLDWSSTHLPEPDAIQESLLY
LYTDKAWTPHVFSLSLESLKCFRLRNNEKLLSDSHGVETIRDILPDTSLGGPAFFKIITA
KAILKLQAGTAEEAALWRALVRKVLASYLETAEEAVTLGGSLDGSCQEVLRVATRENGFL
LQYLVAIPTEKGLDSQGCFCAGCSRQIGFSFVRPKLCAFSGLYYCDICHQDDASVIPARI
IHNWDLSKRP
Download sequence
Identical sequences ENSSARP00000006869 ENSSARP00000006869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]