SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000006894 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000006894
Domain Number 1 Region: 489-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000401
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 259-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000272
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 406-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000102
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 4-46
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000671
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 5 Region: 301-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000006894
Domain Number - Region: 221-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000135
Family EGF-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000006894   Gene: ENSSARG00000007606   Transcript: ENSSART00000007606
Sequence length 645
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6592:44235:226619:-1 gene:ENSSARG00000007606 transcript:ENSSART00000007606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVADACASNPCRHGNCSSGGGSSSGGYFCICEQGYEGPHCEQPLLPDLPAPGWTESTAPR
QLPPAPATPEPEAIAPGSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSA
GGRLVSFEVPQNTSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXFVNESVTKSIVALRLTLVVKTSHCVPAESHGSDVECSGKGRCSTAPSE
ATFSCSCDDQYVGPFCEEFDACQAHPCQNNASCVDAKEKQEGSNFTCVCLAGYTGERCQS
KIDYCVLDPCRNGGTCISDLGGFSCQCPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHGLYCEEEYNECLS
APCLNGATCRDLVNGECVCLAEYKGTHCESYKDPCANVSCLNGGTCDSEGLNGTCICPPG
FTGNQCDIDINECDSNPCHHSGTCLDQPNGYTCHCPHGWVGANCEIHLQWKSGHMAESLT
NMPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRPAYEEFYNCRSIDSEFSS
AIASIRHARFGKKSRPAMYDVTPIAYEDYSPDDKPLVTLIKTKDL
Download sequence
Identical sequences ENSSARP00000006894 ENSSARP00000006894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]