SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008162 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000008162
Domain Number 1 Region: 281-386
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-34
Family Second domain of FERM 0.00000441
Further Details:      
 
Domain Number 2 Region: 385-480
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-31
Family Third domain of FERM 0.000011
Further Details:      
 
Domain Number 3 Region: 251-280
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000765
Family First domain of FERM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008162   Gene: ENSSARG00000009008   Transcript: ENSSART00000009013
Sequence length 986
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_717:755:128286:-1 gene:ENSSARG00000009008 transcript:ENSSART00000009013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSASEVKKEPDQVGADAAKEKPNEVTENQNQSTEPSPTAESQSSPRRRQKREKDP
SESRGISRFIPPWLKKQKSYNLVVAKDGGDKREPSQAVVEEQILDKEESLSEEERQAKGD
AEEIASRKQRKQVEEEKPAVSSPETQPAEAVPKKGEEKVKEIQEDKSEGEAAKRETKEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKRAKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXNWLDPAKEIKKQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLR
QDIASGRLPCSFVTHALLGSYTLQAELGDHDPEQHGSSNLSDFQFAPTQTKELEEKVAEL
HRTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDKLRIN
RFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIGI
VDQSLMKDFPGPAGEVSTYGPGVVTTAVVQDGDGRRDIRSPVKGPHVHVTEGKKNSLRVE
GDNIYVRHSNLMLEDLDRAQEEILKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQ
THGSSHETLNVVEEKQQAEVGKDERVITEEMNGKELSAGSGPGEMPKVEPLTQKDSTSLS
SESSSSSESEEEDVGEYRPHHRVTEGTIREEQEEEEEEVEEEAGRAAKVVEREEAVPEAS
PGKQAGPSVITVETVTQENVGEPTMPAEKSVNEGAIKQDMSEEAEEEQHKVNGEVAHVDI
DVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGD
SGTLLTAQTITSDSVSTTTTTHITKTVKGGISETRIEKRIVITGDADIDHDEALAQAIRG
AREQHPDMSVTRVVVHKETELEEGDD
Download sequence
Identical sequences ENSSARP00000008162 ENSSARP00000008162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]