SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008197 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000008197
Domain Number 1 Region: 66-232
Classification Level Classification E-value
Superfamily RUN domain-like 2.75e-46
Family RUN domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 575-616
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000101
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0058
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000008197
Domain Number - Region: 272-319
Classification Level Classification E-value
Superfamily Prefoldin 0.00157
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008197   Gene: ENSSARG00000009050   Transcript: ENSSART00000009056
Sequence length 620
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_178:1729:76887:1 gene:ENSSARG00000009050 transcript:ENSSART00000009056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHED
PNYLMANERMNLMNMAKLSIKGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKK
TFLDQNKSFWGPLELVEKAXXXXXXXXXXXXXXXXXXXTPIGRGRAWLRLALMQKKLSEY
MKALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDANFCMKGEDLDSQVGVIDFS
MYLKDGNSSKGSEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEKSNTKLTEEL
AVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTSEGQALTEARKHLKEETQLRLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSDLGV
KQKSELNSRLEEKTNQMAATIKQLEQRLRQAERGRQSAELDNRLFKQDFGDKINSLQLQV
EALTRQRNQLELELKQEREMTLQYRSIPGKGSQKPEPKMDGKQRIQEENVKLKKPLEESH
RLQSHPEDEQXXXXXXXXXXXXXXXXXXXXXXXSVCKSCKGTFCDACSTNELPLPSSIKP
ERVCNPCHKHLMEQYSSSPA
Download sequence
Identical sequences ENSSARP00000008197 ENSSARP00000008197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]