SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000008927 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000008927
Domain Number 1 Region: 136-263
Classification Level Classification E-value
Superfamily Second domain of FERM 5.23e-30
Family Second domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 47-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000413
Family Ras-binding domain, RBD 0.054
Further Details:      
 
Domain Number 3 Region: 333-369
Classification Level Classification E-value
Superfamily PH domain-like 0.00000418
Family Third domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000008927   Gene: ENSSARG00000009864   Transcript: ENSSART00000009870
Sequence length 1401
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_4009:97272:195741:1 gene:ENSSARG00000009864 transcript:ENSSART00000009870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPKSAFISAAKKAKLRSHPAKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLENGQIK
SFTFDGRTTVKDVIVTLQDRLSLRYIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRT
HYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLAAL
HIYITVSATRPSQRISLKNVEKEWGLEPFLPPSLLQGIKEKSFRKSLSQQLKAHQTHPSS
GTKGSSTQAKLQYLRILNELPPFTGVLFNTVGLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPLVLLMEWPEATNFACLIAGYCRLLLD
SRKMVFSRPSSQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSMGTSPRKPSRSTSP
PADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYDVVPDD
FDATSLDHEPCASRARSYTLDNSLGAEALNFYCDSCKAKYQEPPGPSKGRASGSSRDNMV
DLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIVL
ATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDSLLARKDLPFRIQ
SCATQAVLTAPYSLGRPDSNSSLQPAVTGQSPGPPGARRKVPPSEMQSQRERTYALAMHP
ALSPQLSERKTLSLLPPVPEDKGPSHSRTGLEMSLRAATPTLSEEPVSEQRENLLKEVRA
SPMLTLDSKGSVTPAVISATLQQVVQTQSLATPGSALGSSSLSSGERRLEASGGRPEVSL
LGVSAGKNFKFKMSPVATETSRNAQQQLGTEVSSGARALTDSLVDVLQAVLSEDRLALLQ
IFSPENYLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXSPSCQLRCHSPSCQPRGPSPSSQSRGPSPSCQRRGPSPLRPSA
PSRQVSTMPSRKLETTLDGAPSASKGSTKSKSTRGPFRLRNLFSATFPTRQKKETDERQV
QLQKVKQYELEFLEELLKPPSQGDLTAPEYLQPPAPGRCSCQLRSSPVQQGPGMLREQRR
SCDCKRICRGGRPQAPQTPVPSLRGREQERLPPTQRQPEAGPGLSLSSPITGRHIRSSSL
ESRECRSDPESGVSCLTTCASGGECLGAPNYRKLMRRYSIGELDPGDRASLTSDIYPHPP
LGMLPREAKEVEAGLPLGVGPKSKCLESPTLGDPSYVQVSPETKSPRPMAVFSLPKEVYR
RPAELDEESESSKCCSIRYCF
Download sequence
Identical sequences ENSSARP00000008927 ENSSARP00000008927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]