SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000009915 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000009915
Domain Number 1 Region: 907-1197
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1e-68
Family Complement components 0.00013
Further Details:      
 
Domain Number 2 Region: 1278-1404
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 5.36e-26
Family Alpha-macroglobulin receptor domain 0.0021
Further Details:      
 
Domain Number 3 Region: 742-795
Classification Level Classification E-value
Superfamily E set domains 0.000000000588
Family SVA-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000009915   Gene: ENSSARG00000010948   Transcript: ENSSART00000010987
Sequence length 1442
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_4519:8158:149912:1 gene:ENSSARG00000010948 transcript:ENSSART00000010987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPLQLLLVLLPAAHLFCSCSADPGPQFLVTAPGIIRPGGNVTLGVELLEHSPPQVTVK
AEVLKKANNLSVSVLEAEGVFEKGSFKTLTLPSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPKSNLIQQW
LSVRSDLGVVSKTLQLSSHPILGDWSIQVQVNXXXXXXXXXXXXXXLPTFEVTLKTPLYF
SSNSKDLHGTVTAKYTYGKPVKGEVTLRFSPLSFWGEKKNIKKSLKIDGSANFSFSDKEI
KEVMDFLDERFEYTHASPFGPIEILAIVTESLTGISRNASSNVFIKQHDYVIEFFDYYSA
LKPSLNFTANVKVFRSDDNPLTLEERKNDVVITVTQSNYSSYSNREHSSDEKTVVQTINY
TVPQSGIFKIEIPVLPDSSELQWKASFLDSVNKMKVNGMFKSPSKTYIQLQTREEDIRVG
SPFELVVIGNKPLKDLSYMVVSRGQLVAVGKQKSTTFSLVPENSWAPKACVIVYYVAEDG
EIISDVLKIPVELVFKNKVNLFWSKANAEPSEKVSLRISVTQPHSLVGIVAVDKSVNLMS
MSNDITMENVIQELELYNTGYYLGMFMNSFAVFQECGLSVFTDADLVKDSSDGTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRTLQEFEVTVPDSITSW
VATAFVINDDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKNAAEV
KVTIEKSDQFEILMTSNEVNATKHEQIILVPSEDGKTAFFPVKPTQLGEIPITVTAISSV
ASDAITRRILVKAEGIEKSYSQSVLLDLTDSRLQATTQTLSFSFPPNTVNGSERIQITAV
GDILGSSINGLDSLIRMPYGCGEQNMINFAPNIYVLDYMTKRRQLSENLKEKALSYMRQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLSAFVLRCFIEADPYIDIDENVLHRTYTWLKRH
QKSNGEFWEPGRVINSKLQGGTKSPVTLTAYIVTSLLRYKKYQPNIDVQDSINFLESEFR
GISDSYTLALVTHTLSLVESLNAKEASDMLNWKATREGDVQFWASSVPKHPDSWQPSSQD
IEVSAYALLSHFLQHQVSEGIPIMRWLSRQRNSLGGFVSTQDTVVALKALSEFAAQMNTE
RTNIQVNVSRPTSPNPVKFEIGTQNRFVLQTAELELAQPVEVDISANGFGIAICQLNVIY
NVKESESSRRKRSIETQEAFDLDVAVHENKRDTNHLNLNVCTRFLEPDRSGMALMEVNLL
SGFAVPPDAIPLSEIVKKVEHDHGKLNLYLDSVNETQFCDIAVRNFKVSNIQDASVSIVD
YYEPRRQAVRSYNSEVQLSSCDLCGDAPGCLSCENRALATFSPSLIPFVLPSMLLLSSHY
WL
Download sequence
Identical sequences ENSSARP00000009915 ENSSARP00000009915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]