SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010057 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010057
Domain Number 1 Region: 520-592
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000248
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010057   Gene: ENSSARG00000011142   Transcript: ENSSART00000011139
Sequence length 604
Comment pep:known_by_projection scaffold:COMMON_SHREW1:scaffold_236872:13994:25588:-1 gene:ENSSARG00000011142 transcript:ENSSART00000011139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKMAAAGAAAEPVPGTTTAVAAAAAKDDEEEEEEESLPPCEAVRWAPVGAVAAAEEAGAA
PGSPPDSPGRTLRRLRAERRRLDSALLALSSHFAQVQFRLRQVVRGAPAEQQRLLRELED
FAFRGCPHVLGYGGLEDPAGDEGDGLPGDRPRWRGEEQSEQEKQERLETQREKQKELILQ
LKTQLDDLETFAYQEGSYDSLPQSMVLERQRVIIDELIKKLDMNLNEDLSSLSTDELRQR
VDVAVAQIVNPARVKEQLVEQLKTQIRDLEMFINFIQDEAGSPVPSEGGHCECRAAGKAA
NGATRTGSRRPPGNGKTKADDMKRAQETGLHLMRRALAMLPIFAVSRFGGTTGQIPTTLW
QRGQADPDYSPFLKKLEASVNRLKHWALEHQPHGHVITSANLQDLALGSKDELTMVVRKE
LTVAVRDLLAHGLYASSPGMSLVMAPIACLLPAFSSAPEAMHPWELFVKYYHAKNGRAYV
ESPARKLSQSFALPVGGGTAMTPKQSLLTAIHMVLTEHDPFKRSADSELKALVCMALNEQ
RLVSWVNLICKSGSLIEAHYQPWSYMAHTGFESALNLLSRLSSLKFSLPVDLAVRQLKNI
KDAF
Download sequence
Identical sequences ENSSARP00000010057 ENSSARP00000010057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]