SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000010145 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000010145
Domain Number 1 Region: 212-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 95-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 176-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000571
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000010145
Domain Number - Region: 140-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 64-98
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0021
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000010145   Gene: ENSSARG00000011224   Transcript: ENSSART00000011240
Sequence length 374
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_3334:23837:29739:-1 gene:ENSSARG00000011224 transcript:ENSSART00000011240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGCHCFHLVCLKYILGARVPPARADDCSSHCNLAHGCCAPDGSCRCDPGWEGLHCERC
VKMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHVCTSQSPCRNGGQCVYDGGGEYHCVCP
AGFHGRDCERKAGPCERAGAPCRNGGQCHDDQGFALNFTCRCLASFGGARKVKDEEYLMQ
PCANDATCVDEVNRLSCLCPVSFTDRFCTINLDDCASRPCQRGARCRDLVHDFRCLCPSG
YGGKACELVLPAPGPASTVGLPRAPTGPVPHSVGAGLLRISVKEVVRRQEAGLGESSLLA
VVVFGALTAVLVLSTLLLTLRAWRRGVCPPGPCCSPAPHYAPARQDQECQLSMLPPDTPL
APDLPPEPGKSTAL
Download sequence
Identical sequences ENSSARP00000010145 ENSSARP00000010145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]