SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000011084 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000011084
Domain Number 1 Region: 159-266
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-37
Family Link domain 0.0023
Further Details:      
 
Domain Number 2 Region: 262-360
Classification Level Classification E-value
Superfamily C-type lectin-like 3.04e-29
Family Link domain 0.003
Further Details:      
 
Domain Number 3 Region: 1144-1199
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000007
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 4 Region: 1192-1264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000124
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 5 Region: 988-1024
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000624
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000011084   Gene: ENSSARG00000012249   Transcript: ENSSART00000012270
Sequence length 1299
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2833:4942:23145:1 gene:ENSSARG00000012249 transcript:ENSSART00000012270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGALWVWALGLLMLQTLLLEAAEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVFYYRAARDRYALTFAEARE
ACRMGSATIAAPRHLQAAFEDGLDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRDPHELYDVYCFARELGGEVFYVGPAGRLTLAGARAQCRRQGATLASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPAPAARFDAYCFRAHH
LTPPHGDPEPRSSGDEGEILSAEGPPARELEPSLPAEEEEEEVVTPDFRELMVSSGEEEP
MTVPEKQELPGTPHSTPGVPTPPSMLSQVAGRVWPSSVAPDAHSVQAAGPDTEETPASPP
PRKRGRFKGLNGRHFQHQEPQQGPEGALDAPAPEAAGNYVEPPRATGAASESGWSEDPWA
VLTNEVEGPRSGSVGDRSPPEPWLWPPTGAPLGPPPGSRATDLHPEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXPSTSSGGRGASLMPRATLHLGPWTTAAGPPAGYSGEPGSLMLAGSPGP
TPRASGAADTPTGTSPMSLDPRDAVGVPVIATAASSSSPPPLELESPEPRPRGTQVVLGT
AGPLPQGSPPGKPTLLPPTTASLEEPTSAFSGDSPGTLLPASLSPGTMELDVLAGSPDVE
GFWEETASGEELVPLGTPTSGSAQEAPLDPCENSPCLHGGTCSANGTMYGCSCAVGFAGE
NCEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXQYENWREKQPDNFFAGGEDCVVMVAHESGLWNDVPCNYKLPYVCEKGTVLCGPPPAV
ENASPVGARKAKYNVHATIRYQCHPGFAQHHVAVIRCRSNGHWERPQIVCTRPRRSHRMR
RHHGHHPHHHPHRHRQPGQERRKRHGRPEDWDPEGENFC
Download sequence
Identical sequences ENSSARP00000011084 ENSSARP00000011084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]