SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000011984 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000011984
Domain Number 1 Region: 40-123
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-18
Family SCAN domain 0.00032
Further Details:      
 
Domain Number 2 Region: 440-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000004
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 550-574,603-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000052
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 939-970
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000169
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 1440-1462,1492-1519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000861
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000011984
Domain Number - Region: 1012-1047
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0055
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 1080-1115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00643
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 652-693
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0807
Family Classic zinc finger, C2H2 0.066
Further Details:      
 
Domain Number - Region: 1303-1328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0936
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000011984   Gene: ENSSARG00000013267   Transcript: ENSSART00000013273
Sequence length 1521
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_6900:5342:16461:-1 gene:ENSSARG00000013267 transcript:ENSSART00000013273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPPKFLSTNKPKKSWVPDLYELDSDLSKEPGIIIGEGTTDCEFCHQRFGDFFYVEFAGP
KTLTKLQNLCLDWLQPEACSEKTVELLVLEQYLTILLEKIKHWVQAKKPESCERLVTLLE
NFKMHEPEDDSSSDVPGEDSMNRRDPESLPPRSMYSLCDRDWDRRGRSRNLEPRDHWHHP
RLPRGRLPQQDLPLPMERALPHRELVEDKDEVTPQDAMSNQDDVDLAEDREPQNPIQDNM
ENYRKLLSLVQLAENDGHSYMTQGHSSRSKRSAYPSTSRGLKTVSEAKKATHRRGICEDE
SSHGVIMEKFIKDVSRSSKAGRARDSNDRSQRCPRRPENVWKGLSLTKRGSVIRERGYEA
NASGGVGFHLNSTLVSKKRVTERKRRYQCDTEGQGSTHDQKGYARKRPFECGEMRKAMSL
GSLSSPSFTESQPVDFTVMPYVCDECGRCFSVISEFVEHQIMHTRENLYEYGESFIHSVA
VSEVQKRQAGGKCFECKECGETFSKSTTLAEHREIHAREHLANCKDEEYEEPFMPSPTFS
ELQKMYGKDKFYECKVCKETFLHSSALIEHQKIHGRGNFSCQRERREIFKPSTSLHELQK
MYGKEKLYECQVCAEAFHHSASLKEHQKIHIRGKSFENKGKVCEKTFIPGQKRHQKTFSR
DKFYGFKDDGNAFMPSSNLSEHLKILSRKNLYEGRSYEKSVIRNLPFTESQKSHTITRPP
EHEEEEKAFTISSNPDESQKFPMKEKIYERKPYERSVIHSLAFAEAQKSHSAGSPSRPKA
MAESTIQSADVAEHQKVYAGENPSERKTSERSVIHSLGIFKWPKNRNGNEFVEHHEKGES
SIYVSDFNDKQQKTLRESPNEGSKSNNYKGSVIHSVSHVKSQKTLAGEGSSEFKTDGELP
VSISNICEHQKARAKKKNIECKNYEISVIQSLCFGELGAIHPREKFYKCQVCGESFVHST
DLTEHQKIHDRRKPSGMKNYERSVICSLASTSLQTNYTETQAQCAKVQARSKCRECGECF
ATIRDLGAHQKIYAQEKVHRKKLFGDAVNRGTCYDGRKSLSKNSTTGGVVEDEEEEAADD
SVYSCKDCGLSFADQADLNDHQNVQRHYLINTCKYKQSVIHTNSISEYQQDSIEQLYECP
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGKVFVQGLPFTCFQGSQTERQYECTCGE
LILSPFRPEGHLRVHERDELYDYGSPFVYTSFLTEPPKRVLPFYECKDCCKSFIHIVLTK
HQKLHKEQDVKTDMLLPRVDLQIRGSVEIAEQEVKADKPNGEAEGLDGEAAEPNREAEQP
GGKVEQPRGDANEPDGAGIEDPEKRAEEPEEDVDEPDSAGIEDPEEEDEDEEIEIEEPSY
DCRECGETFTDNSAHREHLTARARVIVCEAGSTYGESSCYAASAVSTSTGTGDNKHFNCD
VCGQLFGDHLSLARHQNTHIG
Download sequence
Identical sequences ENSSARP00000011984 ENSSARP00000011984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]