SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000012535 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000012535
Domain Number 1 Region: 7-171
Classification Level Classification E-value
Superfamily RUN domain-like 1.44e-48
Family RUN domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 533-599
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00082
Further Details:      
 
Weak hits

Sequence:  ENSSARP00000012535
Domain Number - Region: 381-475
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0916
Family Myosin rod fragments 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000012535   Gene: ENSSARG00000013865   Transcript: ENSSART00000013875
Sequence length 603
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_1001:37278:76651:-1 gene:ENSSARG00000013865 transcript:ENSSART00000013875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVRK
SFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMQKKMADYL
RCLIIQRDLLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSM
YLKNEEDIGNKERNVQIAAILDQKNYVEELNRQLXXXXXXXXXXXXXXXXXXXXXXXXLA
IAKNNIIKLQEENHQLRSENKLIIMKTQQQLEVAKVDVETELQTYKHSRQGLDEMYNEAR
RQLRDESQLRQDVENELAVQVSMKQEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAINI
EMYQKLQSSEDGLKEKNEIIARLEEKTNKITAAMRQLEQRLQQAEKAQMAAEDEDKKSLQ
ECQSKSNNLQKQIAQKEKQLVQLETDLKIEKEWRQTLQEDLQKEKDSVSQVKDETQQIVS
LKKFLNLQHENQQLKKIYHEQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKDKEA
THCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELLLPSSPKPVRVCDSCHALLIQRCSS
NLP
Download sequence
Identical sequences ENSSARP00000012535 ENSSARP00000012535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]