SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000012616 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000012616
Domain Number 1 Region: 159-439
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-69
Family Protein kinases, catalytic subunit 0.00000000168
Further Details:      
 
Domain Number 2 Region: 1-95
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000126
Family Pleckstrin-homology domain (PH domain) 0.00000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000012616   Gene: ENSSARG00000013947   Transcript: ENSSART00000013957
Sequence length 467
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_350:290705:468588:-1 gene:ENSSARG00000013947 transcript:ENSSART00000013957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTDFDYKLLSTGKVILREKSGKYYAMKILKKEVIIAKE
VAHTLTESRVDTRHPFTXXXXXXXXXXXXXXXXXXXXXXXLFFHLSRERVFSEDRTRFYG
AEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEY
LAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSD
AKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDT
RYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSSARP00000012616 ENSSARP00000012616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]