SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSARP00000013044 from Sorex araneus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSARP00000013044
Domain Number 1 Region: 389-445,474-678
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.14e-40
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 105-219
Classification Level Classification E-value
Superfamily ARID-like 2.88e-30
Family ARID domain 0.00064
Further Details:      
 
Domain Number 3 Region: 328-390
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.44e-17
Family PHD domain 0.002
Further Details:      
 
Domain Number 4 Region: 1179-1262
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000288
Family PHD domain 0.0079
Further Details:      
 
Domain Number 5 Region: 1642-1703
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000219
Family PHD domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSARP00000013044   Gene: ENSSARG00000014418   Transcript: ENSSART00000014424
Sequence length 1730
Comment pep:known_by_projection genescaffold:COMMON_SHREW1:GeneScaffold_2375:99969:246062:-1 gene:ENSSARG00000014418 transcript:ENSSART00000014424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AALGCEDEPRPLSADVQVLGGLQPASVHLFPSARPGVPLAMAGVGPGGYAAEFVPPPECP
VFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPPFACEIKSFRFTPRVQRLNEL
EAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYSLSKIVASKGGFEMVTKEKKWS
KVGSRLGYLPGKGTGSLLKSHYEKILYPYELFQSGVSLMGVQMPNLDLKEKVEPEVLGAD
VQTSPEPGTRMNILPKRTRRVKSQSESGEVARNTELKKLRIFGAGPKVVGLTMGTKDKED
EVSRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCGRGNNEDKLLLCDGCDDSYHT
FCLIPPLPDVPKGDWRCPKCVAEECNKPREAFGFEQAVREYTLQSFGEMADNFKSDYFNM
PVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGSGFPVKDGQRKMLPEEEEYAL
SGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEP
KTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAG
EFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYRRLRRHCVFSHEELIFKM
AADPECLDVGLAAMVCKELTLMTXXXXXXXXXXXXXGVLMSEEEVFELVPDDERQCSACR
TTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRYPLEDLPSLLYGVKVRAQSYD
TWVSRVTEALSANFSHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQL
LLSKKQKHXQSPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLLDDVEEFHERA
QEAMMDETPDSSKLQLLIDMGSSLYVELPELARLKQELQQARWLDEVRLTLSDPQQVTLD
VMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAKVCLQARPRHSMASLESIVNE
AKNIPAFLPNVLSLKEALQKAREWTTKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLDAL
PQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDIGIYGSGKNRRKKVKELIEKE
KEKDLDLEPLSDLDEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLAKMTMVDRIEE
VKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSSQKKGSSWQAKEVKFLCPLCMRSRR
PRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRARQALATDELSSALAKLSVLS
QRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTVDYDD
EETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEH
AYSSASKSCSQVSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMMVGDLLEVSLD
ETQHIWRILQATHPPSEDRFLHIMEDDSIEEKPLKVKGKDSSEKKRKRKLEKAEQLFGEG
KQKSKELKKMDKPKKKKLKLNAEKSKELNKLAKKLAKEEERKKKKEKAAAAKVEIVKENT
EKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVC
VGVSPEMAENEDYICINCAKKQGPDSPDQAPPPSFLMSYKLPMEDLKETS
Download sequence
Identical sequences ENSSARP00000013044 ENSSARP00000013044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]