SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|544574963|ref|YP_008570487.1| from Escherichia coli E. coli PMV-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|544574963|ref|YP_008570487.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 6.8e-49
Family Lambda phage gpU-like 0.000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|544574963|ref|YP_008570487.1|
Sequence length 131
Comment Phage minor tail protein U [Escherichia coli PMV-1]
Sequence
MKHTELRAAVLDALEKHDTGATLFDGRPAVFDEEDFPAIAVYLTGAEYTGEELDSDTWQA
ELHIEVFLPAQVPDSELDSWMESRIYPVMSDIPALSDLITSMVASGYDYRRDDDAGLWSS
ADLTYVITYEM
Download sequence
Identical sequences A0A073F2U2 A0A080G9D2 A0A0D6IGF3 A0A0H2YXW1 A0A1E2VH03 A0A1X3K282 A0A1X3MD32 A0A2I6TC75 D6I5K9 D8A625 L2VYK2 L2XTE6 Q1RCW1 S0WHM0 S0YJ41 S0ZQY5 S1FBW5 S1LYN0 T5TZE1 T6I471 T6MLF5
gi|386604858|ref|YP_006111158.1| gi|117623359|ref|YP_852272.1| WP_000683145.1.100735 WP_000683145.1.100738 WP_000683145.1.100898 WP_000683145.1.100933 WP_000683145.1.101152 WP_000683145.1.101926 WP_000683145.1.102144 WP_000683145.1.10492 WP_000683145.1.10697 WP_000683145.1.11217 WP_000683145.1.11250 WP_000683145.1.11531 WP_000683145.1.11844 WP_000683145.1.11948 WP_000683145.1.12010 WP_000683145.1.12051 WP_000683145.1.12076 WP_000683145.1.12761 WP_000683145.1.1312 WP_000683145.1.1323 WP_000683145.1.13600 WP_000683145.1.13979 WP_000683145.1.14304 WP_000683145.1.14509 WP_000683145.1.14582 WP_000683145.1.14712 WP_000683145.1.14914 WP_000683145.1.15420 WP_000683145.1.15857 WP_000683145.1.15990 WP_000683145.1.1622 WP_000683145.1.17568 WP_000683145.1.17584 WP_000683145.1.1763 WP_000683145.1.17757 WP_000683145.1.17952 WP_000683145.1.1802 WP_000683145.1.18134 WP_000683145.1.18628 WP_000683145.1.1867 WP_000683145.1.18828 WP_000683145.1.18962 WP_000683145.1.19146 WP_000683145.1.19374 WP_000683145.1.19379 WP_000683145.1.19465 WP_000683145.1.1963 WP_000683145.1.19655 WP_000683145.1.1987 WP_000683145.1.19873 WP_000683145.1.20230 WP_000683145.1.2027 WP_000683145.1.20515 WP_000683145.1.20709 WP_000683145.1.20761 WP_000683145.1.20765 WP_000683145.1.20863 WP_000683145.1.21634 WP_000683145.1.21714 WP_000683145.1.22189 WP_000683145.1.2245 WP_000683145.1.22494 WP_000683145.1.22543 WP_000683145.1.22549 WP_000683145.1.22685 WP_000683145.1.22939 WP_000683145.1.23230 WP_000683145.1.23561 WP_000683145.1.23962 WP_000683145.1.24169 WP_000683145.1.24170 WP_000683145.1.24592 WP_000683145.1.24758 WP_000683145.1.25021 WP_000683145.1.25079 WP_000683145.1.25141 WP_000683145.1.25174 WP_000683145.1.25183 WP_000683145.1.25270 WP_000683145.1.2540 WP_000683145.1.2606 WP_000683145.1.26092 WP_000683145.1.26574 WP_000683145.1.26627 WP_000683145.1.26659 WP_000683145.1.26782 WP_000683145.1.2695 WP_000683145.1.27260 WP_000683145.1.2755 WP_000683145.1.27797 WP_000683145.1.27932 WP_000683145.1.2794 WP_000683145.1.28051 WP_000683145.1.285 WP_000683145.1.28842 WP_000683145.1.28919 WP_000683145.1.29194 WP_000683145.1.29377 WP_000683145.1.29429 WP_000683145.1.29513 WP_000683145.1.29820 WP_000683145.1.29821 WP_000683145.1.29855 WP_000683145.1.29884 WP_000683145.1.29979 WP_000683145.1.30269 WP_000683145.1.30401 WP_000683145.1.30536 WP_000683145.1.30570 WP_000683145.1.30762 WP_000683145.1.30853 WP_000683145.1.30905 WP_000683145.1.31142 WP_000683145.1.31347 WP_000683145.1.31559 WP_000683145.1.3181 WP_000683145.1.31823 WP_000683145.1.31863 WP_000683145.1.31898 WP_000683145.1.32394 WP_000683145.1.32443 WP_000683145.1.32718 WP_000683145.1.32811 WP_000683145.1.33217 WP_000683145.1.33525 WP_000683145.1.33563 WP_000683145.1.33638 WP_000683145.1.34117 WP_000683145.1.34294 WP_000683145.1.3432 WP_000683145.1.34913 WP_000683145.1.35744 WP_000683145.1.35985 WP_000683145.1.36132 WP_000683145.1.36158 WP_000683145.1.3624 WP_000683145.1.36414 WP_000683145.1.36496 WP_000683145.1.365 WP_000683145.1.36545 WP_000683145.1.3668 WP_000683145.1.36799 WP_000683145.1.37101 WP_000683145.1.37122 WP_000683145.1.37313 WP_000683145.1.37419 WP_000683145.1.37445 WP_000683145.1.37538 WP_000683145.1.37543 WP_000683145.1.37736 WP_000683145.1.37758 WP_000683145.1.38162 WP_000683145.1.38194 WP_000683145.1.38293 WP_000683145.1.39327 WP_000683145.1.39373 WP_000683145.1.39575 WP_000683145.1.39818 WP_000683145.1.40019 WP_000683145.1.40121 WP_000683145.1.40319 WP_000683145.1.41113 WP_000683145.1.41263 WP_000683145.1.41346 WP_000683145.1.41481 WP_000683145.1.41847 WP_000683145.1.4189 WP_000683145.1.42228 WP_000683145.1.42350 WP_000683145.1.42413 WP_000683145.1.42771 WP_000683145.1.43422 WP_000683145.1.43427 WP_000683145.1.4356 WP_000683145.1.43733 WP_000683145.1.43803 WP_000683145.1.44251 WP_000683145.1.44460 WP_000683145.1.44759 WP_000683145.1.4541 WP_000683145.1.45440 WP_000683145.1.45494 WP_000683145.1.45740 WP_000683145.1.45990 WP_000683145.1.46263 WP_000683145.1.4657 WP_000683145.1.46833 WP_000683145.1.46991 WP_000683145.1.47039 WP_000683145.1.47054 WP_000683145.1.47322 WP_000683145.1.47344 WP_000683145.1.47349 WP_000683145.1.47363 WP_000683145.1.47529 WP_000683145.1.47740 WP_000683145.1.47848 WP_000683145.1.48121 WP_000683145.1.48522 WP_000683145.1.48629 WP_000683145.1.49061 WP_000683145.1.49147 WP_000683145.1.49363 WP_000683145.1.49376 WP_000683145.1.49522 WP_000683145.1.49528 WP_000683145.1.49662 WP_000683145.1.497 WP_000683145.1.49794 WP_000683145.1.4985 WP_000683145.1.50136 WP_000683145.1.50616 WP_000683145.1.50700 WP_000683145.1.50887 WP_000683145.1.51325 WP_000683145.1.51380 WP_000683145.1.51495 WP_000683145.1.51525 WP_000683145.1.518 WP_000683145.1.51896 WP_000683145.1.51899 WP_000683145.1.51944 WP_000683145.1.51968 WP_000683145.1.51979 WP_000683145.1.5199 WP_000683145.1.52002 WP_000683145.1.52135 WP_000683145.1.52363 WP_000683145.1.52568 WP_000683145.1.53587 WP_000683145.1.53690 WP_000683145.1.53693 WP_000683145.1.54102 WP_000683145.1.54388 WP_000683145.1.54394 WP_000683145.1.54875 WP_000683145.1.55179 WP_000683145.1.55197 WP_000683145.1.55273 WP_000683145.1.55472 WP_000683145.1.55550 WP_000683145.1.55888 WP_000683145.1.56302 WP_000683145.1.56469 WP_000683145.1.56932 WP_000683145.1.57492 WP_000683145.1.57854 WP_000683145.1.57904 WP_000683145.1.58009 WP_000683145.1.58414 WP_000683145.1.58424 WP_000683145.1.58429 WP_000683145.1.58459 WP_000683145.1.58514 WP_000683145.1.58657 WP_000683145.1.58692 WP_000683145.1.58940 WP_000683145.1.5927 WP_000683145.1.59291 WP_000683145.1.59611 WP_000683145.1.59730 WP_000683145.1.59894 WP_000683145.1.59912 WP_000683145.1.59980 WP_000683145.1.60477 WP_000683145.1.60591 WP_000683145.1.60630 WP_000683145.1.60654 WP_000683145.1.60901 WP_000683145.1.613 WP_000683145.1.61442 WP_000683145.1.61524 WP_000683145.1.61663 WP_000683145.1.61858 WP_000683145.1.62038 WP_000683145.1.62236 WP_000683145.1.6245 WP_000683145.1.62481 WP_000683145.1.62812 WP_000683145.1.62819 WP_000683145.1.6282 WP_000683145.1.62866 WP_000683145.1.62951 WP_000683145.1.63491 WP_000683145.1.63814 WP_000683145.1.64008 WP_000683145.1.64138 WP_000683145.1.64312 WP_000683145.1.64448 WP_000683145.1.64540 WP_000683145.1.64875 WP_000683145.1.65085 WP_000683145.1.65110 WP_000683145.1.65355 WP_000683145.1.65415 WP_000683145.1.65677 WP_000683145.1.65749 WP_000683145.1.65912 WP_000683145.1.6599 WP_000683145.1.66001 WP_000683145.1.66071 WP_000683145.1.66251 WP_000683145.1.66255 WP_000683145.1.66392 WP_000683145.1.66667 WP_000683145.1.66668 WP_000683145.1.66700 WP_000683145.1.66984 WP_000683145.1.67055 WP_000683145.1.67284 WP_000683145.1.67373 WP_000683145.1.67495 WP_000683145.1.67581 WP_000683145.1.67704 WP_000683145.1.67758 WP_000683145.1.67760 WP_000683145.1.68058 WP_000683145.1.68079 WP_000683145.1.68126 WP_000683145.1.68231 WP_000683145.1.6859 WP_000683145.1.68735 WP_000683145.1.68838 WP_000683145.1.68877 WP_000683145.1.68911 WP_000683145.1.694 WP_000683145.1.69502 WP_000683145.1.69569 WP_000683145.1.69872 WP_000683145.1.69887 WP_000683145.1.70300 WP_000683145.1.70386 WP_000683145.1.70408 WP_000683145.1.70896 WP_000683145.1.7102 WP_000683145.1.71037 WP_000683145.1.71409 WP_000683145.1.71607 WP_000683145.1.71830 WP_000683145.1.71912 WP_000683145.1.71938 WP_000683145.1.71972 WP_000683145.1.72048 WP_000683145.1.72054 WP_000683145.1.72153 WP_000683145.1.72258 WP_000683145.1.72425 WP_000683145.1.72551 WP_000683145.1.72596 WP_000683145.1.72695 WP_000683145.1.72706 WP_000683145.1.7309 WP_000683145.1.73278 WP_000683145.1.73430 WP_000683145.1.7407 WP_000683145.1.74184 WP_000683145.1.744 WP_000683145.1.74520 WP_000683145.1.74528 WP_000683145.1.74611 WP_000683145.1.74623 WP_000683145.1.74767 WP_000683145.1.75087 WP_000683145.1.75155 WP_000683145.1.75515 WP_000683145.1.75672 WP_000683145.1.75973 WP_000683145.1.76019 WP_000683145.1.76057 WP_000683145.1.76194 WP_000683145.1.76335 WP_000683145.1.76384 WP_000683145.1.76466 WP_000683145.1.76547 WP_000683145.1.76596 WP_000683145.1.77007 WP_000683145.1.77070 WP_000683145.1.77081 WP_000683145.1.77253 WP_000683145.1.77432 WP_000683145.1.7747 WP_000683145.1.77511 WP_000683145.1.77657 WP_000683145.1.78187 WP_000683145.1.78340 WP_000683145.1.78368 WP_000683145.1.78586 WP_000683145.1.78622 WP_000683145.1.78895 WP_000683145.1.79090 WP_000683145.1.79308 WP_000683145.1.79368 WP_000683145.1.79478 WP_000683145.1.79800 WP_000683145.1.79936 WP_000683145.1.80343 WP_000683145.1.804 WP_000683145.1.80519 WP_000683145.1.80545 WP_000683145.1.80558 WP_000683145.1.81186 WP_000683145.1.81347 WP_000683145.1.81396 WP_000683145.1.81418 WP_000683145.1.81589 WP_000683145.1.81624 WP_000683145.1.81739 WP_000683145.1.82008 WP_000683145.1.82589 WP_000683145.1.82853 WP_000683145.1.82901 WP_000683145.1.83160 WP_000683145.1.83218 WP_000683145.1.83238 WP_000683145.1.83313 WP_000683145.1.83393 WP_000683145.1.83481 WP_000683145.1.83506 WP_000683145.1.83668 WP_000683145.1.83936 WP_000683145.1.84060 WP_000683145.1.84197 WP_000683145.1.84326 WP_000683145.1.84675 WP_000683145.1.84877 WP_000683145.1.85320 WP_000683145.1.85781 WP_000683145.1.8603 WP_000683145.1.86266 WP_000683145.1.86586 WP_000683145.1.86707 WP_000683145.1.86760 WP_000683145.1.8679 WP_000683145.1.86959 WP_000683145.1.8705 WP_000683145.1.87067 WP_000683145.1.87504 WP_000683145.1.87590 WP_000683145.1.87635 WP_000683145.1.87980 WP_000683145.1.88234 WP_000683145.1.88260 WP_000683145.1.88577 WP_000683145.1.88717 WP_000683145.1.89069 WP_000683145.1.89197 WP_000683145.1.89427 WP_000683145.1.89747 WP_000683145.1.89920 WP_000683145.1.90602 WP_000683145.1.90758 WP_000683145.1.90844 WP_000683145.1.91018 WP_000683145.1.9119 WP_000683145.1.91482 WP_000683145.1.91814 WP_000683145.1.91887 WP_000683145.1.91893 WP_000683145.1.92053 WP_000683145.1.93267 WP_000683145.1.93694 WP_000683145.1.94035 WP_000683145.1.9420 WP_000683145.1.94704 WP_000683145.1.95310 WP_000683145.1.95364 WP_000683145.1.95858 WP_000683145.1.96015 WP_000683145.1.96114 WP_000683145.1.96177 WP_000683145.1.96253 WP_000683145.1.96478 WP_000683145.1.9649 WP_000683145.1.96633 WP_000683145.1.96676 WP_000683145.1.96695 WP_000683145.1.96797 WP_000683145.1.97248 WP_000683145.1.97282 WP_000683145.1.97525 WP_000683145.1.97654 WP_000683145.1.97778 WP_000683145.1.97895 WP_000683145.1.98005 WP_000683145.1.98284 WP_000683145.1.98727 WP_000683145.1.98775 WP_000683145.1.9940 WP_000683145.1.99401 WP_000683145.1.9950 364106.UTI89_C1321 405955.APECO1_256 gi|544574963|ref|YP_008570487.1| gi|544575617|ref|YP_008571141.1| gi|91210348|ref|YP_540334.1| gi|386598287|ref|YP_006099793.1| gi|386598986|ref|YP_006100492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]